Recombinant Human LEPRE1 protein, His-tagged
Cat.No. : | LEPRE1-2692H |
Product Overview : | Recombinant Human LEPRE1 protein(23-109 aa), fused to His tag, was expressed in E. coli. |
Availability | June 12, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 23-109 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | EVESEAGWGMVTPDLLFAEGTAAYARGDWPGVVLSMERALRSRAALRALRLRCRTQCAADFPWELDPDWSPSPAQASGAAALRDLSF |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | LEPRE1 leucine proline-enriched proteoglycan (leprecan) 1 [ Homo sapiens ] |
Official Symbol | LEPRE1 |
Synonyms | LEPRE1; leucine proline-enriched proteoglycan (leprecan) 1; prolyl 3-hydroxylase 1; GROS1; growth suppressor 1; LEPRECAN; MGC117314; P3H1; prolyl 3 hydroxylase 1; leprecan; leucine- and proline-enriched proteoglycan 1; OI8; |
Gene ID | 64175 |
mRNA Refseq | NM_001146289 |
Protein Refseq | NP_001139761 |
MIM | 610339 |
UniProt ID | Q32P28 |
◆ Recombinant Proteins | ||
LEPRE1-3377R | Recombinant Rat LEPRE1 Protein | +Inquiry |
LEPRE1-9050M | Recombinant Mouse LEPRE1 Protein | +Inquiry |
LEPRE1-1119C | Recombinant Chicken LEPRE1 | +Inquiry |
LEPRE1-3033R | Recombinant Rat LEPRE1 Protein, His (Fc)-Avi-tagged | +Inquiry |
LEPRE1-29940TH | Recombinant Human LEPRE1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LEPRE1-4772HCL | Recombinant Human LEPRE1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LEPRE1 Products
Required fields are marked with *
My Review for All LEPRE1 Products
Required fields are marked with *
0
Inquiry Basket