Recombinant Human LGALS7B Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | LGALS7B-4976H |
Product Overview : | LGALS7B MS Standard C13 and N15-labeled recombinant protein (NP_001035972) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. Differential and in situ hybridization studies indicate that this lectin is specifically expressed in keratinocytes and found mainly in stratified squamous epithelium. A duplicate copy of this gene (GeneID:3963) is found adjacent to, but on the opposite strand on chromosome 19. |
Molecular Mass : | 15.1 kDa |
AA Sequence : | MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | LGALS7B galectin 7B [ Homo sapiens (human) ] |
Official Symbol | LGALS7B |
Synonyms | LGALS7B; lectin, galactoside-binding, soluble, 7B; galectin-7; GAL7; galectin 7B; galectin-7B; p53-induced protein 1; keratinocyte lectin 14; p53-induced gene 1 protein; lectin galactoside-binding soluble 7; PI7; Gal-7; HKL-14; LGALS7; MGC75149; MGC88745; |
Gene ID | 653499 |
mRNA Refseq | NM_001042507 |
Protein Refseq | NP_001035972 |
MIM | 617139 |
UniProt ID | P47929 |
◆ Recombinant Proteins | ||
LGALS7B-4976H | Recombinant Human LGALS7B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
LGALS7B-3350H | Recombinant Human LGALS7B Protein, His (Fc)-Avi-tagged | +Inquiry |
LGALS7B-26559TH | Recombinant Human LGALS7B | +Inquiry |
LGALS7B-1603H | Recombinant Human LGALS7B | +Inquiry |
◆ Cell & Tissue Lysates | ||
LGALS7B-4764HCL | Recombinant Human LGALS7B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LGALS7B Products
Required fields are marked with *
My Review for All LGALS7B Products
Required fields are marked with *
0
Inquiry Basket