Recombinant Human LGALS9C Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: LGALS9C-635H
• Product Overview: LGALS9C MS Standard C13 and N15-labeled recombinant protein (NP_001035167) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene was initially thought to represent a pseudogene of galectin 9; however, this transcript has good exon-intron structure and encodes a predicted protein of the same size as and highly similar to galectin 9. This gene is one of two similar loci on chromosome 17p similar to galectin 9 and now thought to be protein-encoding. This gene is the more telomeric gene.
• Molecular Mass: 39.6 kDa
• AA Sequence: MAFSGCQAPYLSPAVPFSGTIQGGLQDGFQITVNGAVLSCSGTRFAVDFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQKGTWGPEERKMHMPFQKGMPFDLCFLVQSSDFKVMVNGSLFVQYFHRVPFHRVDTISVNGSVQLSYISFQNPRAVPVQPAFSTVPFSQPVCFPPRPRGRRQKPPIVRPANPAPITQTVIHTVQSASGQMFSQTPAIPPMMYPHPAYPMPFITTIPGGLYPSKSIILSGTVLPSAQRFHINLCSGSHIAFHMNPRFDENAVVRNTQINNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHVFEYYHRLRNLPTINKLEVGGDIQLTHVQTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: LGALS9C galectin 9C [ Homo sapiens (human) ]
• Official Symbol: LGALS9C
• Synonyms: LGALS9C; galectin 9C; Gal-9B; LGALS9B; galectin-9C; Galectin-9-like protein A; Galectin-9B; gal-9C; galectin 9 like; galectin-9-like protein B; lectin, galactoside-binding, soluble, 9 (galectin 9) pseudogene; lectin, galactoside-binding, soluble, 9C
• Gene ID: 654346
• mRNA Refseq: NM_001040078
• Protein Refseq: NP_001035167
• UniProt ID: Q6DKI2