Recombinant Human LGALS9C Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : LGALS9C-635H
Product Overview : LGALS9C MS Standard C13 and N15-labeled recombinant protein (NP_001035167) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene was initially thought to represent a pseudogene of galectin 9; however, this transcript has good exon-intron structure and encodes a predicted protein of the same size as and highly similar to galectin 9. This gene is one of two similar loci on chromosome 17p similar to galectin 9 and now thought to be protein-encoding. This gene is the more telomeric gene.
Molecular Mass : 39.6 kDa
AA Sequence : MAFSGCQAPYLSPAVPFSGTIQGGLQDGFQITVNGAVLSCSGTRFAVDFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQKGTWGPEERKMHMPFQKGMPFDLCFLVQSSDFKVMVNGSLFVQYFHRVPFHRVDTISVNGSVQLSYISFQNPRAVPVQPAFSTVPFSQPVCFPPRPRGRRQKPPIVRPANPAPITQTVIHTVQSASGQMFSQTPAIPPMMYPHPAYPMPFITTIPGGLYPSKSIILSGTVLPSAQRFHINLCSGSHIAFHMNPRFDENAVVRNTQINNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHVFEYYHRLRNLPTINKLEVGGDIQLTHVQTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name LGALS9C galectin 9C [ Homo sapiens (human) ]
Official Symbol LGALS9C
Synonyms LGALS9C; galectin 9C; Gal-9B; LGALS9B; galectin-9C; Galectin-9-like protein A; Galectin-9B; gal-9C; galectin 9 like; galectin-9-like protein B; lectin, galactoside-binding, soluble, 9 (galectin 9) pseudogene; lectin, galactoside-binding, soluble, 9C
Gene ID 654346
mRNA Refseq NM_001040078
Protein Refseq NP_001035167
UniProt ID Q6DKI2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LGALS9C Products

Required fields are marked with *

My Review for All LGALS9C Products

Required fields are marked with *

0
cart-icon