Recombinant Human LGI3 protein, His-tagged
| Cat.No. : | LGI3-7575H |
| Product Overview : | Recombinant Human LGI3 protein(367-548 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 367-548 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
| AASequence : | IVSSSSQAPVIYQWSRTQKQFVAQGEVTQVPDAQAVKHFRAGRDSYLCLSRYIGDSKILRWEGTRFSEVQALPSRGSLALQPFLVGGRRYLALGSDFSFTQIYQWDEGRQKFVRFQELAVQAPRAFCYMPAGDAQLLLAPSFKGQTLVYRHIVVDLSA |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | LGI3 leucine-rich repeat LGI family, member 3 [ Homo sapiens ] |
| Official Symbol | LGI3 |
| Synonyms | LGI3; leucine-rich repeat LGI family, member 3; leucine-rich repeat LGI family member 3; LGI1-like protein 4; leucine-rich glioma-inactivated protein 3; LGIL4; |
| Gene ID | 203190 |
| mRNA Refseq | NM_139278 |
| Protein Refseq | NP_644807 |
| MIM | 608302 |
| UniProt ID | Q8N145 |
| ◆ Recombinant Proteins | ||
| LGI3-555H | Recombinant Human LGI3, His-tagged | +Inquiry |
| LGI3-2504R | Recombinant Rhesus monkey LGI3 Protein, His-tagged | +Inquiry |
| LGI3-3646Z | Recombinant Zebrafish LGI3 | +Inquiry |
| Lgi3-2330M | Recombinant Mouse Lgi3 protein, His&Myc-tagged | +Inquiry |
| LGI3-2325R | Recombinant Rhesus Macaque LGI3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LGI3 Products
Required fields are marked with *
My Review for All LGI3 Products
Required fields are marked with *
