"LGMN" Related Products

Expand
Expand
Expand

Recombinant Human LGMN protein, T7/His-tagged

Cat.No.: LGMN-216H
Product Overview: Recombinant human LGMN (416aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.4 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFVPIDDPEDGGKHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPD EQIVVMMYDDIAYSEDNPTPGIVINRPNGTDVYQGVPKDYTGEDVTPQNFLAVLRGDAEAVKGIGSGKVLKSGPQ DHVFIYFTDHGSTGILVFPNEDLHVKDLNETIHYMYKHKMYRKMVFYIEACESGSMMNHLPDNINVYATTAANPR ESSYACYYDEKRSTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTNTSHVMQYGNKTISTMKVMQFQGMKR KASSPVPLPPVTHLDLTPSPDVPLTIMKRKLMNTNDLEESRQLTEEIQRHLDARHLIEKSVRKIVSLLAASEAEV EQLLSERAPLTGHSCYPEALLHFRTHCFNWHSPTYEYALRHLYVLVNLCEKPYPLHRIKLSMDHVCLGHY
Purity: >90% by SDS-PAGE
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: LGMN legumain [ Homo sapiens ]
Official Symbol: LGMN
Synonyms: LGMN; legumain; protease, cysteine, 1 (legumain) , PRSC1; LGMN1; cysteine protease 1; protease, cysteine 1; asparaginyl endopeptidase; protease, cysteine, 1 (legumain); AEP; PRSC1;
Gene ID: 5641
mRNA Refseq: NM_001008530
Protein Refseq: NP_001008530
MIM: 602620
UniProt ID: Q99538
Chromosome Location: 14q32.12
Pathway: Antigen processing and presentation, organism-specific biosystem; Antigen processing and presentation, conserved biosystem; Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; Lysosome, organism-specific biosystem; Lysosome, conserved biosystem; Metabolism, organism-specific biosystem;
Function: cysteine-type endopeptidase activity; cysteine-type endopeptidase activity; peptidase activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.