Recombinant Human LIFR
| Cat.No. : | LIFR-28855TH |
| Product Overview : | Recombinant fragment of Human LIFR with N terminal proprietary tag, 37.73kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 110 amino acids |
| Description : | This gene encodes a protein that belongs to the type I cytokine receptor family. This protein combines with a high-affinity converter subunit, gp130, to form a receptor complex that mediates the action of the leukemia inhibitory factor, a polyfunctional cytokine that is involved in cellular differentiation, proliferation and survival in the adult and the embryo. Mutations in this gene cause Schwartz-Jampel syndrome type 2, a disease belonging to the group of the bent-bone dysplasias. A translocation that involves the promoter of this gene, t(5;8)(p13;q12) with the pleiomorphic adenoma gene 1, is associated with salivary gland pleiomorphic adenoma, a common type of benign epithelial tumor of the salivary gland. Multiple splice variants encoding the same protein have been found for this gene. |
| Molecular Weight : | 37.730kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | QKKGAPHDLKCVTNNLQVWNCSWKAPSGTGRGTDYEVCIE NRSRSCYQLEKTSIKIPALSHGDYEITINSLHDFGSSTSK FTLNEQNVSLIPDTPEILNLSADFSTSTLY |
| Gene Name | LIFR leukemia inhibitory factor receptor alpha [ Homo sapiens ] |
| Official Symbol | LIFR |
| Synonyms | LIFR; leukemia inhibitory factor receptor alpha; leukemia inhibitory factor receptor; CD118; |
| Gene ID | 3977 |
| mRNA Refseq | NM_001127671 |
| Protein Refseq | NP_001121143 |
| MIM | 151443 |
| Uniprot ID | P42702 |
| Chromosome Location | 5p13-p12 |
| Pathway | Adipogenesis, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem; |
| Function | contributes_to ciliary neurotrophic factor receptor activity; ciliary neurotrophic factor receptor binding; cytokine binding; growth factor binding; leukemia inhibitory factor receptor activity; |
| ◆ Recombinant Proteins | ||
| Lifr-8774R | Recombinant Rat Lifr, His tagged | +Inquiry |
| LIFR-687H | Active Recombinant Human LIFR | +Inquiry |
| Lifr-2820M | Recombinant Mouse Lifr protein, His-tagged | +Inquiry |
| Lifr-2825R | Recombinant Rat Lifr protein, His-tagged | +Inquiry |
| LIFR-4445H | Recombinant Human LIFR Protein (Met1-Ser833), C-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LIFR-1200RCL | Recombinant Rat LIFR cell lysate | +Inquiry |
| LIFR-2778HCL | Recombinant Human LIFR cell lysate | +Inquiry |
| LIFR-2285MCL | Recombinant Mouse LIFR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LIFR Products
Required fields are marked with *
My Review for All LIFR Products
Required fields are marked with *
