Recombinant Human LIFR
Cat.No. : | LIFR-28855TH |
Product Overview : | Recombinant fragment of Human LIFR with N terminal proprietary tag, 37.73kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 110 amino acids |
Description : | This gene encodes a protein that belongs to the type I cytokine receptor family. This protein combines with a high-affinity converter subunit, gp130, to form a receptor complex that mediates the action of the leukemia inhibitory factor, a polyfunctional cytokine that is involved in cellular differentiation, proliferation and survival in the adult and the embryo. Mutations in this gene cause Schwartz-Jampel syndrome type 2, a disease belonging to the group of the bent-bone dysplasias. A translocation that involves the promoter of this gene, t(5;8)(p13;q12) with the pleiomorphic adenoma gene 1, is associated with salivary gland pleiomorphic adenoma, a common type of benign epithelial tumor of the salivary gland. Multiple splice variants encoding the same protein have been found for this gene. |
Molecular Weight : | 37.730kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | QKKGAPHDLKCVTNNLQVWNCSWKAPSGTGRGTDYEVCIE NRSRSCYQLEKTSIKIPALSHGDYEITINSLHDFGSSTSK FTLNEQNVSLIPDTPEILNLSADFSTSTLY |
Gene Name | LIFR leukemia inhibitory factor receptor alpha [ Homo sapiens ] |
Official Symbol | LIFR |
Synonyms | LIFR; leukemia inhibitory factor receptor alpha; leukemia inhibitory factor receptor; CD118; |
Gene ID | 3977 |
mRNA Refseq | NM_001127671 |
Protein Refseq | NP_001121143 |
MIM | 151443 |
Uniprot ID | P42702 |
Chromosome Location | 5p13-p12 |
Pathway | Adipogenesis, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem; |
Function | contributes_to ciliary neurotrophic factor receptor activity; ciliary neurotrophic factor receptor binding; cytokine binding; growth factor binding; leukemia inhibitory factor receptor activity; |
◆ Recombinant Proteins | ||
LIFR-1663H | Recombinant Human Leukemia Inhibitory Factor Receptor Alpha | +Inquiry |
Lifr-2823R | Recombinant Rat Lifr protein, His-tagged | +Inquiry |
LIFR-868M | Active Recombinant Mouse LIFR protein(Met1-Ser828), His-tagged | +Inquiry |
LIFR-687H | Active Recombinant Human LIFR | +Inquiry |
LIFR-0358H | Recombinant Human LIFR protein, hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LIFR-2285MCL | Recombinant Mouse LIFR cell lysate | +Inquiry |
LIFR-1200RCL | Recombinant Rat LIFR cell lysate | +Inquiry |
LIFR-2778HCL | Recombinant Human LIFR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LIFR Products
Required fields are marked with *
My Review for All LIFR Products
Required fields are marked with *
0
Inquiry Basket