Recombinant Human LIFR

Cat.No. : LIFR-28855TH
Product Overview : Recombinant fragment of Human LIFR with N terminal proprietary tag, 37.73kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 110 amino acids
Description : This gene encodes a protein that belongs to the type I cytokine receptor family. This protein combines with a high-affinity converter subunit, gp130, to form a receptor complex that mediates the action of the leukemia inhibitory factor, a polyfunctional cytokine that is involved in cellular differentiation, proliferation and survival in the adult and the embryo. Mutations in this gene cause Schwartz-Jampel syndrome type 2, a disease belonging to the group of the bent-bone dysplasias. A translocation that involves the promoter of this gene, t(5;8)(p13;q12) with the pleiomorphic adenoma gene 1, is associated with salivary gland pleiomorphic adenoma, a common type of benign epithelial tumor of the salivary gland. Multiple splice variants encoding the same protein have been found for this gene.
Molecular Weight : 37.730kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QKKGAPHDLKCVTNNLQVWNCSWKAPSGTGRGTDYEVCIE NRSRSCYQLEKTSIKIPALSHGDYEITINSLHDFGSSTSK FTLNEQNVSLIPDTPEILNLSADFSTSTLY
Gene Name LIFR leukemia inhibitory factor receptor alpha [ Homo sapiens ]
Official Symbol LIFR
Synonyms LIFR; leukemia inhibitory factor receptor alpha; leukemia inhibitory factor receptor; CD118;
Gene ID 3977
mRNA Refseq NM_001127671
Protein Refseq NP_001121143
MIM 151443
Uniprot ID P42702
Chromosome Location 5p13-p12
Pathway Adipogenesis, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem;
Function contributes_to ciliary neurotrophic factor receptor activity; ciliary neurotrophic factor receptor binding; cytokine binding; growth factor binding; leukemia inhibitory factor receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LIFR Products

Required fields are marked with *

My Review for All LIFR Products

Required fields are marked with *

0
cart-icon