Recombinant Human LILRA5 protein, His-tagged

Cat.No. : LILRA5-3176H
Product Overview : Recombinant Human LILRA5 protein(A6NI73)(42-268aa), fused to N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 42-268aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 29.2 kDa
AA Sequence : GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 [ Homo sapiens ]
Official Symbol LILRA5
Synonyms LILRA5; leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5; LILRB7; leukocyte immunoglobulin-like receptor subfamily A member 5; CD85; CD85f; ILT11; LIR9; leukocyte Ig-like receptor 9; CD85 antigen-like family member F; leukocyte immunoglobulin-like receptor 9; immunoglobulin-like transcript 11 protein; leukocyte immunoglobulin-like receptor subfamily A member 5 soluble; leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 7; CD85F; LIR-9; ILT-11;
Gene ID 353514
mRNA Refseq NM_021250
Protein Refseq NP_067073
MIM 606047
UniProt ID A6NI73

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LILRA5 Products

Required fields are marked with *

My Review for All LILRA5 Products

Required fields are marked with *

0
cart-icon