Recombinant Human LILRA5 protein, His-tagged
Cat.No. : | LILRA5-3176H |
Product Overview : | Recombinant Human LILRA5 protein(A6NI73)(42-268aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 42-268aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 29.2 kDa |
AA Sequence : | GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 [ Homo sapiens ] |
Official Symbol | LILRA5 |
Synonyms | LILRA5; leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5; LILRB7; leukocyte immunoglobulin-like receptor subfamily A member 5; CD85; CD85f; ILT11; LIR9; leukocyte Ig-like receptor 9; CD85 antigen-like family member F; leukocyte immunoglobulin-like receptor 9; immunoglobulin-like transcript 11 protein; leukocyte immunoglobulin-like receptor subfamily A member 5 soluble; leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 7; CD85F; LIR-9; ILT-11; |
Gene ID | 353514 |
mRNA Refseq | NM_021250 |
Protein Refseq | NP_067073 |
MIM | 606047 |
UniProt ID | A6NI73 |
◆ Recombinant Proteins | ||
Lilra5-264H | Active Recombinant Mouse Lilra5 protein, His-tagged | +Inquiry |
LILRA5-1444H | Recombinant Human LILRA5 Protein (42-268 aa), His-tagged | +Inquiry |
Lilra5-8778R | Recombinant Rat Lilra5 protein(Met1-Asn248), hFc-tagged | +Inquiry |
LILRA5-759H | Recombinant Human LILRA5 Protein, Fc-tagged | +Inquiry |
LILRA5-3176H | Recombinant Human LILRA5 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LILRA5-1359RCL | Recombinant Rat LILRA5 cell lysate | +Inquiry |
LILRA5-1384RCL | Recombinant Rat LILRA5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LILRA5 Products
Required fields are marked with *
My Review for All LILRA5 Products
Required fields are marked with *