Recombinant Human LILRB1 protein, His-tagged
Cat.No. : | LILRB1-3670H |
Product Overview : | Recombinant Human LILRB1 protein(137-241 aa), fused to His tag, was expressed in E. coli. |
Availability | July 09, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 137-241 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | SGGNVTLQCDSQVAFDGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPEET |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | LILRB1 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 1 [ Homo sapiens ] |
Official Symbol | LILRB1 |
Synonyms | LILRB1; leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 1; leukocyte immunoglobulin-like receptor subfamily B member 1; CD85; CD85j; ILT2; LIR 1; LIR1; MIR 7; ILT-2; CD85 antigen; Ig-like transcript 2; leukocyte Ig-like receptor-1; immunoglobulin-like transcript 2; CD85 antigen-like family member J; leukocyte immunoglobulin-like receptor 1; monocyte/macrophage immunoglobulin-like receptor 7; leukocyte immunoglobulin-like receptor subfamily B member 1 soluble isoform; MIR7; CD85J; LIR-1; MIR-7; FLJ37515; |
Gene ID | 10859 |
mRNA Refseq | NM_001081637 |
Protein Refseq | NP_001075106 |
MIM | 604811 |
UniProt ID | Q8NHL6 |
◆ Recombinant Proteins | ||
LILRB1-3670H | Recombinant Human LILRB1 protein, His-tagged | +Inquiry |
LILRB1-1722R | Recombinant Rhesus macaque LILRB1 protein, His-tagged | +Inquiry |
LILRB1-3936H | Recombinant Human LILRB1 Protein (Gly24-His458), C-His tagged | +Inquiry |
LILRB1-5052H | Recombinant Human LILRB1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
LILRB1-0333C | Recombinant Cynomolgus LILRB1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LILRB1-774HCL | Recombinant Human LILRB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LILRB1 Products
Required fields are marked with *
My Review for All LILRB1 Products
Required fields are marked with *