Recombinant Human LILRB1 protein, His-tagged

• Cat.No.: LILRB1-3670H
• Product Overview: Recombinant Human LILRB1 protein(137-241 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 137-241 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AASequence: SGGNVTLQCDSQVAFDGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPEET
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: LILRB1 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 1 [ Homo sapiens ]
• Official Symbol: LILRB1
• Synonyms: LILRB1; leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 1; leukocyte immunoglobulin-like receptor subfamily B member 1; CD85; CD85j; ILT2; LIR 1; LIR1; MIR 7; ILT-2; CD85 antigen; Ig-like transcript 2; leukocyte Ig-like receptor-1; immunoglobulin-like transcript 2; CD85 antigen-like family member J; leukocyte immunoglobulin-like receptor 1; monocyte/macrophage immunoglobulin-like receptor 7; leukocyte immunoglobulin-like receptor subfamily B member 1 soluble isoform; MIR7; CD85J; LIR-1; MIR-7; FLJ37515
• Gene ID: 10859
• mRNA Refseq: NM_001081637
• Protein Refseq: NP_001075106
• MIM: 604811
• UniProt ID: Q8NHL6