Recombinant Human LILRB1 protein, His-tagged

Cat.No. : LILRB1-3670H
Product Overview : Recombinant Human LILRB1 protein(137-241 aa), fused to His tag, was expressed in E. coli.
Availability July 30, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 137-241 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : SGGNVTLQCDSQVAFDGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPEET
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name LILRB1 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 1 [ Homo sapiens ]
Official Symbol LILRB1
Synonyms LILRB1; leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 1; leukocyte immunoglobulin-like receptor subfamily B member 1; CD85; CD85j; ILT2; LIR 1; LIR1; MIR 7; ILT-2; CD85 antigen; Ig-like transcript 2; leukocyte Ig-like receptor-1; immunoglobulin-like transcript 2; CD85 antigen-like family member J; leukocyte immunoglobulin-like receptor 1; monocyte/macrophage immunoglobulin-like receptor 7; leukocyte immunoglobulin-like receptor subfamily B member 1 soluble isoform; MIR7; CD85J; LIR-1; MIR-7; FLJ37515;
Gene ID 10859
mRNA Refseq NM_001081637
Protein Refseq NP_001075106
MIM 604811
UniProt ID Q8NHL6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LILRB1 Products

Required fields are marked with *

My Review for All LILRB1 Products

Required fields are marked with *

0
cart-icon