Recombinant Human LILRB3 Protein, His-tagged
Cat.No. : | LILRB3-012H |
Product Overview : | Recombinant Human LILRB3 Protein with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | May act as receptor for class I MHC antigens. Becomes activated upon coligation of LILRB3 and immune receptors, such as FCGR2B and the B-cell receptor. Down-regulates antigen-induced B-cell activation by recruiting phosphatases to its immunoreceptor tyrosine-based inhibitor motifs (ITIM). |
Molecular Mass : | ~52 kDa |
AA Sequence : | GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLE |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | LILRB3 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 3 [ Homo sapiens (human) ] |
Official Symbol | LILRB3 |
Synonyms | LILRB3; leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 3; leukocyte immunoglobulin-like receptor subfamily B member 3; CD85a; HL9; ILT5; LIR 3; LIR3; immunoglobulin-like transcript 5; monocyte inhibitory receptor HL9; CD85 antigen-like family member A; leukocyte immunoglobulin-like receptor 3; PIRB; CD85A; ILT-5; LIR-3; MGC138403; |
Gene ID | 11025 |
mRNA Refseq | NM_001081450 |
Protein Refseq | NP_001074919 |
MIM | 604820 |
UniProt ID | O75022 |
◆ Recombinant Proteins | ||
LILRB3-7060H | Recombinant Human LILRB3 protein, His-tagged | +Inquiry |
LILRB3-3356H | Recombinant Human LILRB3 protein(Met1-Glu443), His-tagged | +Inquiry |
LILRB3-362H | Recombinant Human LILRB3 protein, Fc-tagged | +Inquiry |
Lilrb3-5332M | Recombinant Mouse Lilrb3 protein, His-tagged | +Inquiry |
LILRB3-1445M | Recombinant Mouse LILRB3 Protein (664-841 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LILRB3-1653MCL | Recombinant Mouse LILRB3 cell lysate | +Inquiry |
LILRB3-2208HCL | Recombinant Human LILRB3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LILRB3 Products
Required fields are marked with *
My Review for All LILRB3 Products
Required fields are marked with *