Recombinant Human LIMD2 protein, GST-tagged
| Cat.No. : | LIMD2-3177H |
| Product Overview : | Recombinant Human LIMD2 protein(Q9BT23)(1-127aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-127aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 41.1 kDa |
| AA Sequence : | MFQAAGAAQATPSHDAKGGGSSTVQRSKSFSLRAQVKETCAACQKTVYPMERLVADKLIFHNSCFCCKHCHTKLSLGSYAALHGEFYCKPHFQQLFKSKGNYDEGFGRKQHKELWAHKEVDPGTKTA |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | LIMD2 LIM domain containing 2 [ Homo sapiens ] |
| Official Symbol | LIMD2 |
| Synonyms | LIMD2; LIM domain containing 2; LIM domain-containing protein 2; MGC10986; |
| Gene ID | 80774 |
| mRNA Refseq | NM_030576 |
| Protein Refseq | NP_085053 |
| UniProt ID | Q9BT23 |
| ◆ Recombinant Proteins | ||
| LIMD2-15878H | Recombinant Human LIMD2, His-tagged | +Inquiry |
| LIMD2-1474C | Recombinant Chicken LIMD2 | +Inquiry |
| LIMD2-3411R | Recombinant Rat LIMD2 Protein | +Inquiry |
| LIMD2-2519R | Recombinant Rhesus monkey LIMD2 Protein, His-tagged | +Inquiry |
| Limd2-3784M | Recombinant Mouse Limd2 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LIMD2-4741HCL | Recombinant Human LIMD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LIMD2 Products
Required fields are marked with *
My Review for All LIMD2 Products
Required fields are marked with *



