Recombinant Human LIMD2 protein, GST-tagged
Cat.No. : | LIMD2-3177H |
Product Overview : | Recombinant Human LIMD2 protein(Q9BT23)(1-127aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-127aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 41.1 kDa |
AA Sequence : | MFQAAGAAQATPSHDAKGGGSSTVQRSKSFSLRAQVKETCAACQKTVYPMERLVADKLIFHNSCFCCKHCHTKLSLGSYAALHGEFYCKPHFQQLFKSKGNYDEGFGRKQHKELWAHKEVDPGTKTA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | LIMD2 LIM domain containing 2 [ Homo sapiens ] |
Official Symbol | LIMD2 |
Synonyms | LIMD2; LIM domain containing 2; LIM domain-containing protein 2; MGC10986; |
Gene ID | 80774 |
mRNA Refseq | NM_030576 |
Protein Refseq | NP_085053 |
UniProt ID | Q9BT23 |
◆ Recombinant Proteins | ||
LIMD2-3411R | Recombinant Rat LIMD2 Protein | +Inquiry |
LIMD2-4772H | Recombinant Human LIMD2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
LIMD2-2339R | Recombinant Rhesus Macaque LIMD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
LIMD2-15878H | Recombinant Human LIMD2, His-tagged | +Inquiry |
LIMD2-1474C | Recombinant Chicken LIMD2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
LIMD2-4741HCL | Recombinant Human LIMD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LIMD2 Products
Required fields are marked with *
My Review for All LIMD2 Products
Required fields are marked with *
0
Inquiry Basket