Recombinant Human LIMK1 protein, GST-tagged
| Cat.No. : | LIMK1-321H |
| Product Overview : | Recombinant Human LIMK1(1 a.a. - 647 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1-647 a.a. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 96.8 kDa |
| AA Sequence : | MRLTLLCCTWREERMGEEGSELPVCASCGQRIYDGQYLQALNADWHADCFRCCDCSASLSHQYYEKDGQLFCKKDYWARYGESCHGCSEQITKGLVMVAGELKYHPECFICLTCGTFIGDGDTYTLVEHSKLYCGHCYYQTVVTPVIEQILPDSPGSHLPHTVTLVSIPASSHGKRGLSVSIDPPHGPPGCGTEHSHTVRVQGVDPGCMSPDVKNSIHVGDRILEINGTPIRNVPLDEIDLLIQETSRLLQLTLEHDPHDTLGHGLGPETSPLSSPAYTPSGEAGSSARQKPVLRSCSIDRSPGAGSLGSPASQRKDLGRSESLRVVCRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGTLRGIIKSMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENKNVVVADFGLARLMVDEKTQPEGLRSLKKPDRKKRYTVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLCEIIGRVNADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRRGESGLPAHPEVPD |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | LIMK1 LIM domain kinase 1 [ Homo sapiens ] |
| Official Symbol | LIMK1 |
| Synonyms | LIMK1; LIM domain kinase 1; LIMK; LIM motif-containing protein kinase; LIMK-1; |
| Gene ID | 3984 |
| mRNA Refseq | NM_002314 |
| Protein Refseq | NP_002305 |
| MIM | 601329 |
| UniProt ID | P53667 |
| Chromosome Location | 7q11.23 |
| Pathway | Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; Axon guidance, organism-specific biosystem; Axon guidance, organism-specific biosystem; CDC42 signaling events, organism-specific biosystem; CXCR4-mediated signaling events, organism-specific biosystem; Caspase cascade in apoptosis, organism-specific biosystem; |
| Function | ATP binding; heat shock protein binding; metal ion binding; nucleotide binding; protein binding; protein kinase activity; protein serine/threonine kinase activity; zinc ion binding; |
| ◆ Recombinant Proteins | ||
| LIMK1-5707C | Recombinant Chicken LIMK1 | +Inquiry |
| LIMK1-1176H | Recombinant Human LIMK1 Protein (R329-G638), Tag Free | +Inquiry |
| LIMK1-131H | Recombinant Human LIMK1, GST-tagged | +Inquiry |
| LIMK1-1542H | Active Recombinant human LIMK1, GST-tagged | +Inquiry |
| LIMK1-675HF | Recombinant Full Length Human LIMK1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LIMK1-4739HCL | Recombinant Human LIMK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LIMK1 Products
Required fields are marked with *
My Review for All LIMK1 Products
Required fields are marked with *
