Recombinant Human LIN54 protein, GST-tagged
Cat.No. : | LIN54-301282H |
Product Overview : | Recombinant Human LIN54 (555-631 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Leu555-Arg631 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | LADAAEVRVQQQTAAKTKLSSQISDLLTRPTPALNSGGGKLPFTFVTKEVAEATCNCLLAQAEQADKKGKSKAAAER |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | LIN54 lin-54 DREAM MuvB core complex component [ Homo sapiens (human) ] |
Official Symbol | LIN54 |
Synonyms | TCX1; JC8.6; CXCDC1; MIP120 |
Gene ID | 132660 |
Protein Refseq | NP_001108479 |
MIM | 613367 |
UniProt ID | Q6MZP7 |
◆ Recombinant Proteins | ||
LIN54-4474Z | Recombinant Zebrafish LIN54 | +Inquiry |
LIN54-3069R | Recombinant Rat LIN54 Protein, His (Fc)-Avi-tagged | +Inquiry |
LIN54-301282H | Recombinant Human LIN54 protein, GST-tagged | +Inquiry |
LIN54-2875H | Recombinant Human LIN54 protein, His-tagged | +Inquiry |
LIN54-9116M | Recombinant Mouse LIN54 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LIN54 Products
Required fields are marked with *
My Review for All LIN54 Products
Required fields are marked with *
0
Inquiry Basket