Recombinant Human LINC00174 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: LINC00174-4607H
• Product Overview: LOC285908 MS Standard C13 and N15-labeled recombinant protein (NP_859073) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: LINC00174 (Long Intergenic Non-Protein Coding RNA 174) is an RNA Gene, and is affiliated with the lncRNA class.
• Molecular Mass: 21.7 kDa
• AA Sequence: MASAGPNRPEISLARNSTCVGCPNNHSFSRTVAHGGRALASAWPPQAQFLPVGGRSRPGSCPSASSPGPELVPVGLSRPSSPGHLHGPSSCLTTTTFGPAPAQLLAAVVGPRLPCVQASRTHLRLSGGPERPGSCLPAASPGPAAASRRPPQATFPPASRQPRQARLPPAGGLLRRLISCPAAASPGQAPACRQAPQAQLLRPEGFSRPGSCLAAASTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: LINC00174 long intergenic non-protein coding RNA 174 [ Homo sapiens (human) ]
• Official Symbol: LINC00174
• Synonyms: LINC00174; long intergenic non-protein coding RNA 174; NCRNA00174
• Gene ID: 285908
• mRNA Refseq: NM_181722
• Protein Refseq: NP_859073