"LINGO1" Related Products

Expand

Recombinant Human LINGO1 Protein, His-tagged

Cat.No.: LINGO1-001H
Product Overview: Recombinant human LINGO1 (a non-glycosylated polypeptide chain containing 133 amino acids (241-337 a.a)) fused to a 36 amino acid His-tag at N-terminus was expressed in E.coli.
Description: Leucine Rich Repeat And Ig Domain Containing 1, also known as Lingo1 is primarily expressed in neuronal tissue, and most abundantly in the cortex. In addition, Lingo 1 is involved in the inhibition of axon regeneration all the way through a ternary complex formed with NgR1 (ligand-binding subunit) and p75 (signal transducing subunit). The inhibitory action is accomplished through RhoA-GTP upregulation in response to the presence of MOG, MAG or Nogo-66 in the central nervous system. Furthermore, LINGO-1 inhibits oligodendrocyte precursor differentiation as well as myelination, by a mechanism which also involves activation of RhoA, however it appears that it does not require 75 or NgR1.
Source: E. coli
Species: Human
Tag : His
Molecular Mass: 15.1kDa
AA Sequence: MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSLKVLEISHWPYLDTMTPNCLYGLNLTSLSITHCNLTAVPYLAVRHLVYLRFLNLSYNPISTIEGSMLHELLRLQEIQLVGGQLAVVEPYAFRGLNYL
Purity: Greater than 90.0% as determined by SDS-PAGE.
Storage: Store at 4 centigrade if entire vial will be used within 2-4 weeks. Store, frozen at -20 centigrade for longer periods of time.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid multiple freeze-thaw cycles.
Concentration: 1mg/mL
Storage Buffer: 20mM Tris-HCl buffer (pH 8.0) and 10% glycerol
Gene Name: LINGO1
Official Symbol: LINGO1 leucine rich repeat and Ig domain containing 1 [ Homo sapiens (human) ]
Synonyms: Leucine Rich Repeat And Ig Domain Containing 1; LRRN6A; Leucine-Rich Repeat And Immunoglobulin Domain-Containing Protein 1; Leucine-Rich Repeat Neuronal Protein 1; Leucine Rich Repeat Neuronal 6A; LERN1; Leucine-Rich Repeat And Immunoglobulin-Like Domain-Containing Nogo Receptor-Interacting Protein 1; Leucine-Rich Repeat Neuronal Protein 6A; UNQ201; LERN1; Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1; LINGO1; leucine rich repeat and Ig domain containing 1; ERN1
Gene ID: 84894
mRNA Refseq: NM_001301186
Protein Refseq: NP_001288115
MIM: 609791
UniProt ID: Q96FE5

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.