Recombinant Human LIPH, His-tagged
Cat.No. : | LIPH-127H |
Product Overview : | Recombinant Human Lipase Member H/LIPH is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Glu19-Leu451) of Human LIPH fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 19-451 a.a. |
Description : | Lipase Member H (LIPH) is a secreted protein that is a member of the Lipase family of AB hydrolase superfamily. LIPH catalyzes the production of 2-acyl lysophosphatidic acid (LPA), which is a lipid mediator with diverse biological properties that include platelet aggregation, smooth muscle contraction, and stimulation of cell proliferation and motility. However, LIPH does not hydrolyze other phospholipids, like phosphatidylserine (PS), phosphatidylcholine (PC) and phosphatidylethanolamine (PE) or triacylglycerol (TG). |
AA Sequence : | EETCPSFTRLSFHSAVVGTGLNVRLMLYTRKNLTCAQTINSS AFGNLNVTKKTTFIVHGFRPT GSPPVWMDDLVKGLLSVEDMNVVVVDWNRGATTLIYTHASSKTRKVAMVLKEFIDQMLAEGASLD DIYMIGVSLGAHISGFVGEMYDGWLGRITGLDPAGPLFNGKPHQDRLDPSDAQFVDVIHSDTDAL GYKEPLGNIDFYPNGGLDQPGCPKTILGGFQYFKCDHQRSVYLYLSSLRESCTITAYPCDSYQDY RNGKCVSCGTSQKESCPLLGYYADNWKDHLRGKDPPMTKAFFDTAEESPFCMYHYFVDIITWNKN VRRGDITIKLRDKAGNTTESKINHEPTTFQKYHQVSLLARFNQDLDKVAAISLMFSTGSLIGPRY KLRILRMKLRSLAHPERPQLCRYDLVLMENVETVFQPILCPELQL |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Gene Name | LIPH lipase, member H [ Homo sapiens ] |
Official Symbol | LIPH |
Synonyms | LIPH; lipase, member H; lipase member H; mPA PLA1; PLA1B; lipase H; mPA-PLA1 alpha; phospholipase A1 member B; LPD lipase-related protein; membrane-bound phosphatidic acid-selective phospholipase A1; membrane-associated phosphatidic acid-selective phospholipase A1-alpha; AH; LAH2; ARWH2; LPDLR; mPA-PLA1; |
Gene ID | 200879 |
mRNA Refseq | NM_139248 |
Protein Refseq | NP_640341 |
MIM | 607365 |
UniProt ID | Q8WWY8 |
Chromosome Location | 3q27 |
Function | heparin binding; hydrolase activity; phospholipase activity; |
◆ Recombinant Proteins | ||
LIPH-5100M | Recombinant Mouse LIPH Protein, His (Fc)-Avi-tagged | +Inquiry |
LIPH-9131M | Recombinant Mouse LIPH Protein | +Inquiry |
LIPH-3420R | Recombinant Rat LIPH Protein | +Inquiry |
LIPH-3076R | Recombinant Rat LIPH Protein, His (Fc)-Avi-tagged | +Inquiry |
LIPH-127H | Recombinant Human LIPH, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LIPH-988HCL | Recombinant Human LIPH cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LIPH Products
Required fields are marked with *
My Review for All LIPH Products
Required fields are marked with *
0
Inquiry Basket