Recombinant Human LOC284912 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : LOC284912-3381H
Product Overview : LOC284912 MS Standard C13 and N15-labeled recombinant protein (NP_976309) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : LOC284912 (Uncharacterized LOC284912) is an RNA Gene, and is affiliated with the ncRNA class.
Molecular Mass : 8.7 kDa
AA Sequence : MELLSPQSPFRVDRGEHLPFLVKGARYTLVPAGQEGGGQTWRPLPGTTSPEDSSHLHRGQKKGAALGMAVYPYNCQAHAPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name LOC284912 uncharacterized LOC284912 [ Homo sapiens (human) ]
Official Symbol LOC284912
Synonyms LOC284912; uncharacterized LOC284912; MGC3170
Gene ID 284912
mRNA Refseq NM_203375
Protein Refseq NP_976309

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LOC284912 Products

Required fields are marked with *

My Review for All LOC284912 Products

Required fields are marked with *

0
cart-icon
0
compare icon