Recombinant Human LOC284912 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: LOC284912-3381H
• Product Overview: LOC284912 MS Standard C13 and N15-labeled recombinant protein (NP_976309) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: LOC284912 (Uncharacterized LOC284912) is an RNA Gene, and is affiliated with the ncRNA class.
• Molecular Mass: 8.7 kDa
• AA Sequence: MELLSPQSPFRVDRGEHLPFLVKGARYTLVPAGQEGGGQTWRPLPGTTSPEDSSHLHRGQKKGAALGMAVYPYNCQAHAPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: LOC284912 uncharacterized LOC284912 [ Homo sapiens (human) ]
• Official Symbol: LOC284912
• Synonyms: LOC284912; uncharacterized LOC284912; MGC3170
• Gene ID: 284912
• mRNA Refseq: NM_203375
• Protein Refseq: NP_976309