Recombinant Human LOC494141 Protein, GST-tagged

Cat.No. : LOC494141-4778H
Product Overview : Human LOC494141 full-length ORF ( AAH56262.1, 1 a.a. - 154 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : LOC494141 (Solute Carrier Family 25 Member 51 Pseudogene) is a Pseudogene.
Molecular Mass : 43.9 kDa
AA Sequence : MKKEELKQHDGFRSSWKETTNTNIFETRYVTSYYRFSEMKHYLCGCCAAFNNVAITFLIQKVLFPQQLYGIKTGDAILQLRTDGFRNLYRGIFPRLMQKTTTLALTFGLYEDLSYLLHKHVSAPEFATCGVAAVLAGTTEAIFTSDIASRPQAP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LOC494141 solute carrier family 25 member 51 pseudogene [ Homo sapiens (human) ]
Official Symbol LOC494141
Synonyms LOC494141; solute carrier family 25 member 51 pseudogene; mitochondrial carrier triple repeat 1 pseudogene
Gene ID 494141

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LOC494141 Products

Required fields are marked with *

My Review for All LOC494141 Products

Required fields are marked with *

0
cart-icon
0
compare icon