Recombinant Human LOC541469 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: LOC541469-4668H
• Product Overview: LOC541469 MS Standard C13 and N15-labeled recombinant protein (NP_001013639) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: YIF1B (Yip1 Interacting Factor Homolog B, Membrane Trafficking Protein) is a Protein Coding gene. An important paralog of this gene is YIF1A.
• Molecular Mass: 14.9 kDa
• AA Sequence: MLSCCLEPAAWDCGAEGRDGREEMVLGWKRDRGTTPRTLPASPSAGTPLWGAGHVLGDAGESPLPSHPCPNRWSCCWSRKSCGVLAGWRCGSEAAPLTQPPEVGGLRQDPGVRGNPSLPAPPQPVMRRLTFGPGPAPASDRPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: LOC541469 hypothetical protein LOC541469 [ Homo sapiens (human) ]
• Official Symbol: LOC541469
• Synonyms: LOC541469; hypothetical protein LOC541469
• Gene ID: 541469
• mRNA Refseq: NM_001013617
• Protein Refseq: NP_001013639