Recombinant Human LOC541473 Protein, GST-tagged
| Cat.No. : | LOC541473-4193H |
| Product Overview : | Human FKBP6 full-length ORF ( NP_001013770.1, 1 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | LOC541473 (FK506 Binding Protein 6, 36kDa Pseudogene) is a Pseudogene. |
| Molecular Mass : | 40.9 kDa |
| AA Sequence : | MGGSALNQGVLEGDDAPGQSLYERLSQRMLDISGDRGVLKDVIREGAGDLVAPDASVLVKYYGYLEHLDRPFDSNYFRKTPRLMKLGEDITLWGMELGLLSMQRGELARCFVLGKLLDSQGPSLHLYLRAS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | LOC541473 FK506 binding protein 6, 36kDa pseudogene [ Homo sapiens (human) ] |
| Official Symbol | LOC541473 |
| Synonyms | LOC541473; FK506 binding protein 6, 36kDa pseudogene; MGC88170; FK506 Binding Protein 6, 36kDa Pseudogene 3; AC006014.8 |
| Gene ID | 541473 |
| ◆ Recombinant Proteins | ||
| LOC541473-4193H | Recombinant Human LOC541473 Protein, GST-tagged | +Inquiry |
| LOC541473-4812HF | Recombinant Full Length Human LOC541473 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LOC541473-1018HCL | Recombinant Human LOC541473 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LOC541473 Products
Required fields are marked with *
My Review for All LOC541473 Products
Required fields are marked with *
