Recombinant Human LOC541473 Protein, GST-tagged

• Cat.No.: LOC541473-4193H
• Product Overview: Human FKBP6 full-length ORF ( NP_001013770.1, 1 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: LOC541473 (FK506 Binding Protein 6, 36kDa Pseudogene) is a Pseudogene.
• Molecular Mass: 40.9 kDa
• AA Sequence: MGGSALNQGVLEGDDAPGQSLYERLSQRMLDISGDRGVLKDVIREGAGDLVAPDASVLVKYYGYLEHLDRPFDSNYFRKTPRLMKLGEDITLWGMELGLLSMQRGELARCFVLGKLLDSQGPSLHLYLRAS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LOC541473 FK506 binding protein 6, 36kDa pseudogene [ Homo sapiens (human) ]
• Official Symbol: LOC541473
• Synonyms: LOC541473; FK506 binding protein 6, 36kDa pseudogene; MGC88170; FK506 Binding Protein 6, 36kDa Pseudogene 3; AC006014.8
• Gene ID: 541473