Recombinant Human LOX protein, T7/His-tagged
| Cat.No. : | LOX-157H |
| Product Overview : | Recombinant human LOX cDNA (169 - 417aa, Isoform-1, which derived from BC074872) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Protein Length : | 169-417 a.a. |
| Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFDDPYNPYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPD LVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWH SCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWI DITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY |
| Purity : | >90% by SDS-PAGE |
| Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
| Gene Name | LOX lysyl oxidase [ Homo sapiens ] |
| Official Symbol | LOX |
| Synonyms | LOX; lysyl oxidase; protein-lysine 6-oxidase; MGC105112; |
| Gene ID | 4015 |
| mRNA Refseq | NM_001178102 |
| Protein Refseq | NP_001171573 |
| MIM | 153455 |
| UniProt ID | P28300 |
| Chromosome Location | 5q23.3-q31.2 |
| Function | copper ion binding; metal ion binding; oxidoreductase activity; protein-lysine 6-oxidase activity; |
| ◆ Recombinant Proteins | ||
| LOX-3088R | Recombinant Rat LOX Protein, His (Fc)-Avi-tagged | +Inquiry |
| LOX-189H | Recombinant Human LOX protein, GST-tagged | +Inquiry |
| LOX-4734H | Recombinant Human LOX Protein, GST-tagged | +Inquiry |
| LOX-4451H | Recombinant Human LOX Protein (Asp169-Tyr417), N-His tagged | +Inquiry |
| Lox-1333M | Recombinant Mouse Lox Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Native Proteins | ||
| LOX-41 | Active Native Lactate Oxidase | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LOX-4677HCL | Recombinant Human LOX 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LOX Products
Required fields are marked with *
My Review for All LOX Products
Required fields are marked with *
