Recombinant Human LOXL1 protein, His-tagged
Cat.No. : | LOXL1-2696H |
Product Overview : | Recombinant Human LOXL1 protein(283-366 aa), fused to His tag, was expressed in E. coli. |
Availability | August 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 283-366 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | TPGFEQAYPDPGPEAAQAHGGDPRLGWYPPYANPPPEAYGPPRALEPPYLPVRSSDTPPPGGERNGAQQGRLSVGSVYRPNQNG |
Purity : | 98%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | LOXL1 lysyl oxidase-like 1 [ Homo sapiens ] |
Official Symbol | LOXL1 |
Synonyms | LOXL1; lysyl oxidase-like 1; lysyl oxidase homolog 1; LOL; LOXL; lysyl oxidase-like protein 1; |
Gene ID | 4016 |
mRNA Refseq | NM_005576 |
Protein Refseq | NP_005567 |
MIM | 153456 |
UniProt ID | Q08397 |
◆ Recombinant Proteins | ||
LOXL1-9185M | Recombinant Mouse LOXL1 Protein | +Inquiry |
LOXL1-2696H | Recombinant Human LOXL1 protein, His-tagged | +Inquiry |
LOXL1-1446M | Recombinant Mouse LOXL1 Protein (95-607 aa), His-tagged | +Inquiry |
LOXL1-149H | Recombinant Human LOXL1, GST-tagged | +Inquiry |
Loxl1-271R | Recombinant Rat Loxl1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LOXL1-1028HCL | Recombinant Human LOXL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LOXL1 Products
Required fields are marked with *
My Review for All LOXL1 Products
Required fields are marked with *