"LOXL2" Related Products

Expand

Recombinant Human LOXL2 Protein, GST-tagged

Cat.No. : LOXL2-4731H
Product Overview : Human LOXL2 partial ORF ( NP_002309, 675 a.a. - 773 a.a.) recombinant protein with GST-tag at N-terminal.
Description : This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family. [provided by RefSeq
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 36.63 kDa
AA Sequence : NFGDQGITMGCWDMYRHDIDCQWVDITDVPPGDYLFQVVINPNFEVAESDYSNNIMKCRSRYDGHRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQLSP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : LOXL2 lysyl oxidase-like 2 [ Homo sapiens ]
Official Symbol : LOXL2
Synonyms : LOXL2; lysyl oxidase-like 2; lysyl oxidase homolog 2; WS9 14; lysyl oxidase related 2; lysyl oxidase-like protein 2; lysyl oxidase-related protein 2; lysyl oxidase-related protein WS9-14; LOR2; WS9-14;
Gene ID : 4017
mRNA Refseq : NM_002318
Protein Refseq : NP_002309
MIM : 606663
UniProt ID : Q9Y4K0

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.