Recombinant Human LOXL2 Protein, GST-tagged
Cat.No. : | LOXL2-4731H |
Product Overview : | Human LOXL2 partial ORF ( NP_002309, 675 a.a. - 773 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family. [provided by RefSeq |
Molecular Mass : | 36.63 kDa |
AA Sequence : | NFGDQGITMGCWDMYRHDIDCQWVDITDVPPGDYLFQVVINPNFEVAESDYSNNIMKCRSRYDGHRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQLSP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LOXL2 lysyl oxidase-like 2 [ Homo sapiens ] |
Official Symbol | LOXL2 |
Synonyms | LOXL2; lysyl oxidase-like 2; lysyl oxidase homolog 2; WS9 14; lysyl oxidase related 2; lysyl oxidase-like protein 2; lysyl oxidase-related protein 2; lysyl oxidase-related protein WS9-14; LOR2; WS9-14; |
Gene ID | 4017 |
mRNA Refseq | NM_002318 |
Protein Refseq | NP_002309 |
MIM | 606663 |
UniProt ID | Q9Y4K0 |
◆ Recombinant Proteins | ||
LOXL2-9186M | Active Recombinant Mouse Loxl2 protein, His-tagged | +Inquiry |
Loxl2-5132M | Recombinant Mouse Loxl2 Protein, His (Fc)-Avi-tagged | +Inquiry |
LOXL2-3375H | Recombinant Human LOXL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
LOXL2-37H | Recombinant Human LOXL2 Protein, N-8His tagged, Biotinylated | +Inquiry |
LOXL2-330H | Recombinant Human LOXL2 protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LOXL2-1854HCL | Recombinant Human LOXL2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LOXL2 Products
Required fields are marked with *
My Review for All LOXL2 Products
Required fields are marked with *