Recombinant Human LOXL2 Protein, GST-tagged

Cat.No. : LOXL2-4731H
Product Overview : Human LOXL2 partial ORF ( NP_002309, 675 a.a. - 773 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family. [provided by RefSeq
Molecular Mass : 36.63 kDa
AA Sequence : NFGDQGITMGCWDMYRHDIDCQWVDITDVPPGDYLFQVVINPNFEVAESDYSNNIMKCRSRYDGHRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQLSP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LOXL2 lysyl oxidase-like 2 [ Homo sapiens ]
Official Symbol LOXL2
Synonyms LOXL2; lysyl oxidase-like 2; lysyl oxidase homolog 2; WS9 14; lysyl oxidase related 2; lysyl oxidase-like protein 2; lysyl oxidase-related protein 2; lysyl oxidase-related protein WS9-14; LOR2; WS9-14;
Gene ID 4017
mRNA Refseq NM_002318
Protein Refseq NP_002309
MIM 606663
UniProt ID Q9Y4K0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LOXL2 Products

Required fields are marked with *

My Review for All LOXL2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon