Recombinant Human LPAL2 Protein, GST-tagged
| Cat.No. : | LPAL2-4728H |
| Product Overview : | Human LPAL2 full-length ORF ( AAI66644.1, 1 a.a. - 132 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Apolipoprotein(a) is the distinguishing protein moiety of lipoprotein(a), of which elevated plasma levels are correlated with an increased risk of atherosclerosis. This gene is similar to the lipoprotein, Lp(a) gene, but all transcripts produced by this gene contain a truncated open reading frame and are candidates for nonsense-mediated decay. Consequently, this gene is considered to be a pseudogene. Alternative splicing results in multiple transcript variants. [provided by RefSeq |
| Molecular Mass : | 14.6 kDa |
| AA Sequence : | MEHKEVVLLLLLFLKSAPTETGPSVQECYHSNGQSYRGTYFTTVTGRTCQAWSSMTPHQHSRTPEKYPNDGLISNYCRNPDCSAGPWCYTTDPNVRWEYCNLTRCSDDEGTVFVPLTVIPVPSLEDSFIQVA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | LPAL2 lipoprotein(a) like 2, pseudogene [ Homo sapiens (human) ] |
| Official Symbol | LPAL2 |
| Synonyms | LPAL2; lipoprotein(a) like 2, pseudogene; APOA2; APOAL; APOARGC; apo(a)rg-C; apolipoprotein (a) related gene C; apolipoprotein A-II; lipoprotein, Lp(a)-like 2, pseudogene |
| Gene ID | https://www.ncbi.nlm.nih.gov/gene/80350 |
| MIM | 611682 |
| UniProt ID | Q16609 |
| ◆ Recombinant Proteins | ||
| LPAL2-5967HF | Recombinant Full Length Human LPAL2 Protein, GST-tagged | +Inquiry |
| LPAL2-329H | Recombinant Human LPAL2 protein(Met1-Ala132), mFc-tagged | +Inquiry |
| LPAL2-4728H | Recombinant Human LPAL2 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LPAL2 Products
Required fields are marked with *
My Review for All LPAL2 Products
Required fields are marked with *
