Recombinant Human LPAR5 protein, His-tagged

• Cat.No.: LPAR5-2975H
• Product Overview: Recombinant Human LPAR5 protein(298-372 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 298-372 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: YFSAEGFRNTLRGLGTPHRARTSATNGTRAALAQSERSAVTTDATRPDAASQGLLRPSDSHSLSSFTQCPQDSAL
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: LPAR5 lysophosphatidic acid receptor 5 [ Homo sapiens ]
• Official Symbol: LPAR5
• Synonyms: LPAR5; lysophosphatidic acid receptor 5; G protein coupled receptor 92 , GPR92, GPR93; KPG_010; LPA5; LPA-5; LPA receptor 5; G protein-coupled receptor 92; G-protein coupled receptor 92; G-protein coupled receptor 93; GPR92; GPR93
• Gene ID: 57121
• mRNA Refseq: NM_001142961
• Protein Refseq: NP_001136433
• MIM: 606926
• UniProt ID: Q9H1C0