Recombinant Human LPGAT1 Protein, GST-tagged
Cat.No. : | LPGAT1-4721H |
Product Overview : | Human LPGAT1 full-length ORF ( NP_055688.1, 1 a.a. - 370 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Acyl-CoA:lysophosphatidylglycerol (LPG) acyltransferase catalyzes the reacylation of LPG to phosphatidylglycerol, a membrane phospholipid that is an important precursor for the synthesis of cardiolipin (Yang et al., 2004 [PubMed 15485873]).[supplied by OMIM |
Molecular Mass : | 69.5 kDa |
AA Sequence : | MAITLEEAPWLGWLLVKALMRFAFMVVNNLVAIPSYICYVIILQPLRVLDSKRFWYIEGIMYKWLLGMVASWGWYAGYTVMEWGEDIKAVSKDEAVMLVNHQATGDVCTLMMCLQDKGLVVAQMMWLMDHIFKYTNFGIVSLVHGDFFIRQGRSYRDQQLLLLKKHLENNYRSRDRKWIVLFPEGGFLRKRRETSQAFAKKNNLPFLTNVTLPRSGATKIILNALVAQQKNGSPAGGDAKELDSKSKGLQWIIDTTIAYPKAEPIDIQTWILGYRKPTVTHVHYRIFPIKDVPLETDDLTTWLYQRFVEKEDLLSHFYETGAFPPSKGHKEAVSREMTLSNLWIFLIQSFAFLSGYMWYNIIQYFYHCLF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LPGAT1 lysophosphatidylglycerol acyltransferase 1 [ Homo sapiens ] |
Official Symbol | LPGAT1 |
Synonyms | LPGAT1; lysophosphatidylglycerol acyltransferase 1; FAM34A, family with sequence similarity 34, member A; acyl-CoA:lysophosphatidylglycerol acyltransferase 1; FAM34A1; KIAA0205; NET8; family with sequence similarity 34, member A; FAM34A; |
Gene ID | 9926 |
mRNA Refseq | NM_014873 |
Protein Refseq | NP_055688 |
MIM | 610473 |
UniProt ID | Q92604 |
◆ Recombinant Proteins | ||
RFL25693MF | Recombinant Full Length Mouse Acyl-Coa:Lysophosphatidylglycerol Acyltransferase 1(Lpgat1) Protein, His-Tagged | +Inquiry |
LPGAT1-2729C | Recombinant Chicken LPGAT1 | +Inquiry |
LPGAT1-3186Z | Recombinant Zebrafish LPGAT1 | +Inquiry |
LPGAT1-4721H | Recombinant Human LPGAT1 Protein, GST-tagged | +Inquiry |
LPGAT1-5986HF | Recombinant Full Length Human LPGAT1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LPGAT1-4669HCL | Recombinant Human LPGAT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LPGAT1 Products
Required fields are marked with *
My Review for All LPGAT1 Products
Required fields are marked with *