Recombinant Human LPHN1 Protein
| Cat.No. : | LPHN1-4720H |
| Product Overview : | Human LPHN1 full-length ORF (AAH19928.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Description : | This gene encodes a member of the latrophilin subfamily of G-protein coupled receptors (GPCR). Latrophilins may function in both cell adhesion and signal transduction. In experiments with non-human species, endogenous proteolytic cleavage within a cysteine-rich GPS (G-protein-coupled-receptor proteolysis site) domain resulted in two subunits (a large extracellular N-terminal cell adhesion subunit and a subunit with substantial similarity to the secretin/calcitonin family of GPCRs) being non-covalently bound at the cell membrane. Latrophilin-1 has been shown to recruit the neurotoxin from black widow spider venom, alpha-latrotoxin, to the synapse plasma membrane. Alternative splicing results in multiple variants encoding distinct isoforms |
| Form : | Liquid |
| Molecular Mass : | 20.8 kDa |
| AA Sequence : | MGLISHLERLMAEGKWGGTGVVEGMGMAEEGAGNGKAVWGMGRGKGERSPSLSSTFPQGRRSQVPGLGSGHPCSGRLDPKSQTPEAPGSGCVLSTCPGPLLSSLSGQPPQPPSLNSRGSIAPGHPSPAPALPFPQRWPLHLCSDLSPSLCPSFSHKCHEFSNIFGSQPAAAMNFVGLRGRGSRKELGGRGQVGGWRDPFCC |
| Applications : | Antibody Production Functional Study Compound Screening |
| Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene Name | LPHN1 latrophilin 1 [ Homo sapiens ] |
| Official Symbol | LPHN1 |
| Synonyms | LPHN1; latrophilin 1; latrophilin-1; CIRL1; KIAA0821; LEC2; CIRL-1; lectomedin-2; calcium-independent alpha-latrotoxin receptor 1; CL1; |
| Gene ID | 22859 |
| mRNA Refseq | NM_001008701 |
| Protein Refseq | NP_001008701 |
| UniProt ID | O94910 |
| ◆ Recombinant Proteins | ||
| LPHN1-9200M | Recombinant Mouse LPHN1 Protein | +Inquiry |
| LPHN1-2402H | Recombinant Human LPHN1 Protein, His-tagged | +Inquiry |
| LPHN1-3440R | Recombinant Rat LPHN1 Protein | +Inquiry |
| LPHN1-4720H | Recombinant Human LPHN1 Protein | +Inquiry |
| LPHN1-3096R | Recombinant Rat LPHN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LPHN1-1029HCL | Recombinant Human LPHN1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LPHN1 Products
Required fields are marked with *
My Review for All LPHN1 Products
Required fields are marked with *
