Recombinant Human LPL, His-tagged
Cat.No. : | LPL-28596TH |
Product Overview : | Recombinant full length mature Human Lipoprotein lipase with an N Terminal His tag; 458 amino acids with a predicted MWt of 51.61kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 448 amino acids |
Description : | LPL encodes lipoprotein lipase, which is expressed in heart, muscle, and adipose tissue. LPL functions as a homodimer, and has the dual functions of triglyceride hydrolase and ligand/bridging factor for receptor-mediated lipoprotein uptake. Severe mutations that cause LPL deficiency result in type I hyperlipoproteinemia, while less extreme mutations in LPL are linked to many disorders of lipoprotein metabolism. |
Conjugation : | HIS |
Molecular Weight : | 51.610kDa inclusive of tags |
Form : | Lyophilised:To reconstitute, add 0.1M Acetate buffer pH4.Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80°C for long term storage. Reconstituted protein can be stored at 4°C for a week. In higher concentrations the |
Storage buffer : | pH: 4.00Constituents:0.4% Sodium acetate, 0.3% Acetic acid |
Storage : | Store at -80°C |
Sequences of amino acids : | MKHHHHHHASADQRRDFIDIESKFALRTPEDTAEDTCHLI PGVAESVATCHFNHSSKTFMVIHGWTVTGMYESWVPKLVA ALYKREPDSNVIVVDWLSRAQEHYPVSAGYTKLVGQDVAR FINWMEEEFNYPLDNVHLLGYSLGAHAAGIAGSLTNKKVN RITGLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSP GRSIGIQKPVGHVDIYPNGGTFQPGCNIGEAIRVIAERGL GDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCSSKEAF EKGLCLSCRKNRCNNLGYEISKVRAKRSSKMYLKTRSQMP YKVFHYQVKIHFSGTESETHTNQAFEISLYGTVAESENIP FTLPEVSTNKTYSFLIYTEVDIGELLMLKLKWKSDSYFSW SDWWSSPGFAIQKIRVKAGETQKKVIFCSREKVSHLQKGK APAVFVKCHDKSLNKKSG |
Sequence Similarities : | Belongs to the AB hydrolase superfamily. Lipase family.Contains 1 PLAT domain. |
Gene Name | LPL lipoprotein lipase [ Homo sapiens ] |
Official Symbol | LPL |
Synonyms | LPL; lipoprotein lipase; LIPD; |
Gene ID | 4023 |
mRNA Refseq | NM_000237 |
Protein Refseq | NP_000228 |
Uniprot ID | P06858 |
Chromosome Location | 8p22 |
Pathway | Adipogenesis, organism-specific biosystem; Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Chylomicron-mediated lipid transport, organism-specific biosystem; Developmental Biology, organism-specific biosystem; |
Function | heparin binding; hydrolase activity; lipoprotein lipase activity; lipoprotein lipase activity; lipoprotein lipase activity; |
◆ Recombinant Proteins | ||
LPL-3099R | Recombinant Rat LPL Protein, His (Fc)-Avi-tagged | +Inquiry |
LPL-1015H | Recombinant Human LPL protein, Flag-tagged | +Inquiry |
LPL-658C | Recombinant Cynomolgus LPL Protein, His-tagged | +Inquiry |
LPL-22H | Active Recombinant Human LPL Protein, His-tagged | +Inquiry |
LPL-5717H | Recombinant Human LPL Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
LPL-01B | Active Native Bovine Lipoprotein Lipase | +Inquiry |
◆ Cell & Tissue Lysates | ||
LPL-4665HCL | Recombinant Human LPL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LPL Products
Required fields are marked with *
My Review for All LPL Products
Required fields are marked with *