Recombinant Human LRCH2 protein, GST-tagged
Cat.No. : | LRCH2-30189H |
Product Overview : | Recombinant Human LRCH2 (372-571 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | His372-Lys571 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | HSQVSESNREQTSRNDSHIIGSKTDSQKDQEVYDFVDPNTEDVAVPEQGNAHIGSFVSFFKGKEKCSEKSRKNEELGDEKRLEKEQLLAEEEDDDLKEVTDLRKIAAQLLQQEQKNRILNHSTSVMRNKPKQTVECEKSVSADEVNSPLSPLTWQPLENQKDQIDEQPWPESHPIIWQSEERRRSKQIRKEYFKYKSMRK |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | LRCH2 leucine rich repeats and calponin homology domain containing 2 [ Homo sapiens (human) ] |
Official Symbol | LRCH2 |
Synonyms | dA204F4.4 |
Gene ID | 57631 |
mRNA Refseq | NM_001243963 |
Protein Refseq | NP_001230892 |
UniProt ID | Q5VUJ6 |
◆ Recombinant Proteins | ||
LRCH2-5147M | Recombinant Mouse LRCH2 Protein, His (Fc)-Avi-tagged | +Inquiry |
LRCH2-30189H | Recombinant Human LRCH2 protein, GST-tagged | +Inquiry |
LRCH2-9212M | Recombinant Mouse LRCH2 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LRCH2 Products
Required fields are marked with *
My Review for All LRCH2 Products
Required fields are marked with *
0
Inquiry Basket