Recombinant Human LRIG2 protein, GST-tagged
Cat.No. : | LRIG2-301630H |
Product Overview : | Recombinant Human LRIG2 (220-330 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Leu220-Ala330 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | LELKRNRIKIVEGLTFQGLDSLRSLKMQRNGISKLKDGAFFGLNNMEELELEHNNLTRVNKGWLYGLRMLQQLYVSQNAIERISPDAWEFCQRLSELDLSYNQLTRLDESA |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | LRIG2 leucine-rich repeats and immunoglobulin-like domains 2 [ Homo sapiens ] |
Official Symbol | LRIG2 |
Synonyms | LIG2; LIG-2 |
Gene ID | 9860 |
mRNA Refseq | NM_014813.1 |
Protein Refseq | NP_055628.1 |
MIM | 608869 |
UniProt ID | O94898 |
◆ Recombinant Proteins | ||
LRIG2-301630H | Recombinant Human LRIG2 protein, GST-tagged | +Inquiry |
LRIG2-3198H | Recombinant Human LRIG2 protein, His-tagged | +Inquiry |
LRIG2-5376H | Recombinant Human LRIG2 Protein (Leu42-Thr805), C-His tagged | +Inquiry |
LRIG2-9225M | Recombinant Mouse LRIG2 Protein | +Inquiry |
LRIG2-5156M | Recombinant Mouse LRIG2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LRIG2 Products
Required fields are marked with *
My Review for All LRIG2 Products
Required fields are marked with *