Recombinant Human LRP12 Protein, GST-tagged

Cat.No. : LRP12-4694H
Product Overview : Human LRP12 full-length ORF (-, 1 a.a. - 129 a.a.) recombinant protein with GST tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene was identified by its differential expression in cancer cells. The product of this gene is predicted to be a transmembrane protein. The level of this protein was found to be lower in tumor derived cell lines compared to normal cells. This gene was thus proposed to be a candidate tumor suppressor gene. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Molecular Mass : 39.93 kDa
AA Sequence : MKIFYYALNLELYKTCTKIVQDKFHLVMSFPNTGLRLHWTLGICTKIISRSQMSLVHKHYHFKYYYLLPQQLYISIAFGWGRGTFLLQLEIALLVSYLFVVFKKYIVVRVIFSIYFIPGGDHATLSKEN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LRP12 low density lipoprotein receptor-related protein 12 [ Homo sapiens ]
Official Symbol LRP12
Synonyms LRP12; low density lipoprotein receptor-related protein 12; low-density lipoprotein receptor-related protein 12; FLJ12929; ST7; suppressor of tumorigenicity 7 protein; DKFZp781F1053;
Gene ID 29967
mRNA Refseq NM_001135703
Protein Refseq NP_001129175
UniProt ID Q9Y561

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LRP12 Products

Required fields are marked with *

My Review for All LRP12 Products

Required fields are marked with *

0
cart-icon
0
compare icon