Recombinant Human LRP1B Protein, GST-tagged
Cat.No. : | LRP1B-4693H |
Product Overview : | Human LRP1B partial ORF ( NP_061027, 111 a.a. - 200 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | LRP1B belongs to the low density lipoprotein (LDL) receptor gene family. These receptors play a wide variety of roles in normal cell function and development due to their interactions with multiple ligands (Liu et al., 2001 [PubMed 11384978]).[supplied by OMIM |
Molecular Mass : | 35.42 kDa |
AA Sequence : | VHCQELLSNCQQLNCQYKCTMVRNSTRCYCEDGFEITEDGRSCKDQDECAVYGTCSQTCRNTHGSYTCSCVEGYLMQPDNRSCKAKIEPT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LRP1B LDL receptor related protein 1B [ Homo sapiens (human) ] |
Official Symbol | LRP1B |
Synonyms | LRP1B; LDL receptor related protein 1B; LRP-1B; LRPDIT; LRP-DIT; low-density lipoprotein receptor-related protein 1B; LRP-deleted in tumors; low density lipoprotein receptor related protein-deleted in tumor; low density lipoprotein receptor-related protein 1B; low density lipoprotein-related protein 1B (deleted in tumors) |
Gene ID | https://www.ncbi.nlm.nih.gov/gene/53353 |
mRNA Refseq | NM_018557 |
Protein Refseq | NP_061027 |
MIM | 608766 |
UniProt ID | Q9NZR2 |
◆ Recombinant Proteins | ||
LRP1B-3778H | Recombinant Human LRP1B Protein (Leu31-Lys194), N-His tagged | +Inquiry |
LRP1B-4693H | Recombinant Human LRP1B Protein, GST-tagged | +Inquiry |
LRP1B-7872H | Recombinant Human LRP1B protein, His & T7-tagged | +Inquiry |
Lrp1b-7873M | Recombinant Mouse Lrp1b protein, His & T7-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LRP1B Products
Required fields are marked with *
My Review for All LRP1B Products
Required fields are marked with *
0
Inquiry Basket