Recombinant Human LRP1B Protein, GST-tagged

Cat.No. : LRP1B-4693H
Product Overview : Human LRP1B partial ORF ( NP_061027, 111 a.a. - 200 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : LRP1B belongs to the low density lipoprotein (LDL) receptor gene family. These receptors play a wide variety of roles in normal cell function and development due to their interactions with multiple ligands (Liu et al., 2001 [PubMed 11384978]).[supplied by OMIM
Molecular Mass : 35.42 kDa
AA Sequence : VHCQELLSNCQQLNCQYKCTMVRNSTRCYCEDGFEITEDGRSCKDQDECAVYGTCSQTCRNTHGSYTCSCVEGYLMQPDNRSCKAKIEPT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LRP1B LDL receptor related protein 1B [ Homo sapiens (human) ]
Official Symbol LRP1B
Synonyms LRP1B; LDL receptor related protein 1B; LRP-1B; LRPDIT; LRP-DIT; low-density lipoprotein receptor-related protein 1B; LRP-deleted in tumors; low density lipoprotein receptor related protein-deleted in tumor; low density lipoprotein receptor-related protein 1B; low density lipoprotein-related protein 1B (deleted in tumors)
Gene ID https://www.ncbi.nlm.nih.gov/gene/53353
mRNA Refseq NM_018557
Protein Refseq NP_061027
MIM 608766
UniProt ID Q9NZR2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LRP1B Products

Required fields are marked with *

My Review for All LRP1B Products

Required fields are marked with *

0
cart-icon