Recombinant Human LRP5 protein, GST-tagged

Cat.No. : LRP5-301119H
Product Overview : Recombinant Human LRP5 (1332-1397 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Cys1332-Leu1397
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : CDAICLPNQFRCASGQCVLIKQQCDSFPDCIDGSDELMCEITKPPSDDSPAHSSAIGPVIGIILSL
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name LRP5 low density lipoprotein receptor-related protein 5 [ Homo sapiens ]
Official Symbol LRP5
Synonyms LRP5; low density lipoprotein receptor-related protein 5; EVR1, exudative vitreoretinopathy 1 , LRP7, OPPG, osteoporosis pseudoglioma syndrome; low-density lipoprotein receptor-related protein 5; BMND1; HBM; LR3; OPS; LRP-5; low density lipoprotein receptor-related protein 7; EVR1; EVR4; LRP7; OPPG; OPTA1; VBCH2;
Gene ID 4041
mRNA Refseq NM_002335
Protein Refseq NP_002326
MIM 603506
UniProt ID O75197

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LRP5 Products

Required fields are marked with *

My Review for All LRP5 Products

Required fields are marked with *

0
cart-icon