Recombinant Human LRP5 protein, GST-tagged

• Cat.No.: LRP5-301119H
• Product Overview: Recombinant Human LRP5 (1332-1397 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Cys1332-Leu1397
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: CDAICLPNQFRCASGQCVLIKQQCDSFPDCIDGSDELMCEITKPPSDDSPAHSSAIGPVIGIILSL
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: LRP5 low density lipoprotein receptor-related protein 5 [ Homo sapiens ]
• Official Symbol: LRP5
• Synonyms: LRP5; low density lipoprotein receptor-related protein 5; EVR1, exudative vitreoretinopathy 1 , LRP7, OPPG, osteoporosis pseudoglioma syndrome; low-density lipoprotein receptor-related protein 5; BMND1; HBM; LR3; OPS; LRP-5; low density lipoprotein receptor-related protein 7; EVR1; EVR4; LRP7; OPPG; OPTA1; VBCH2
• Gene ID: 4041
• mRNA Refseq: NM_002335
• Protein Refseq: NP_002326
• MIM: 603506
• UniProt ID: O75197