Recombinant Human LRRC25 protein, HIS-tagged

Cat.No. : LRRC25-023H
Product Overview : Recombinant Human LRRC25 fused with His tag at C-termina was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Form : Lyophilized froma 0.2 µM filtered solution of 20mM PB,150mM NaCl,pH7.4
Molecular Mass : 16.7 kDa
AA Sequence : LEPSCTVSSADVDWNAEFSATCLNFSGLSLSLPHNQSLRASNVILLDLSGNGLRELPVTFFAHLQKLEVLNVLRNPLSRVDGALAARCDLDLQADCNCALESWHDIRRDNCSGQKPLLCWDTTSSQHNLSAFLEVSCAPGLASATVDHHHHHH
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name LRRC25 leucine rich repeat containing 25 [ Homo sapiens ]
Official Symbol LRRC25
Synonyms LRRC25; leucine rich repeat containing 25; leucine-rich repeat-containing protein 25; FLJ38116; MAPA; monocyte and plasmacytoid-activated protein; monocyte and plasmacytoid activated molecule;
Gene ID 126364
mRNA Refseq NM_145256
Protein Refseq NP_660299
MIM 607518
UniProt ID Q8N386

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LRRC25 Products

Required fields are marked with *

My Review for All LRRC25 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon