Recombinant Human LRRC25 protein, HIS-tagged
Cat.No. : | LRRC25-023H |
Product Overview : | Recombinant Human LRRC25 fused with His tag at C-termina was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Form : | Lyophilized froma 0.2 µM filtered solution of 20mM PB,150mM NaCl,pH7.4 |
Molecular Mass : | 16.7 kDa |
AA Sequence : | LEPSCTVSSADVDWNAEFSATCLNFSGLSLSLPHNQSLRASNVILLDLSGNGLRELPVTFFAHLQKLEVLNVLRNPLSRVDGALAARCDLDLQADCNCALESWHDIRRDNCSGQKPLLCWDTTSSQHNLSAFLEVSCAPGLASATVDHHHHHH |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | LRRC25 leucine rich repeat containing 25 [ Homo sapiens ] |
Official Symbol | LRRC25 |
Synonyms | LRRC25; leucine rich repeat containing 25; leucine-rich repeat-containing protein 25; FLJ38116; MAPA; monocyte and plasmacytoid-activated protein; monocyte and plasmacytoid activated molecule; |
Gene ID | 126364 |
mRNA Refseq | NM_145256 |
Protein Refseq | NP_660299 |
MIM | 607518 |
UniProt ID | Q8N386 |
◆ Recombinant Proteins | ||
LRRC25-4009H | Recombinant Human LRRC25 Protein (Leu21-Thr165), C-His tagged | +Inquiry |
LRRC25-023H | Recombinant Human LRRC25 protein, HIS-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LRRC25-4640HCL | Recombinant Human LRRC25 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LRRC25 Products
Required fields are marked with *
My Review for All LRRC25 Products
Required fields are marked with *