Recombinant Human LRRC25 protein, HIS-tagged

• Cat.No.: LRRC25-023H
• Product Overview: Recombinant Human LRRC25 fused with His tag at C-termina was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Form: Lyophilized froma 0.2 µM filtered solution of 20mM PB,150mM NaCl,pH7.4
• Molecular Mass: 16.7 kDa
• AA Sequence: LEPSCTVSSADVDWNAEFSATCLNFSGLSLSLPHNQSLRASNVILLDLSGNGLRELPVTFFAHLQKLEVLNVLRNPLSRVDGALAARCDLDLQADCNCALESWHDIRRDNCSGQKPLLCWDTTSSQHNLSAFLEVSCAPGLASATVDHHHHHH
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: LRRC25 leucine rich repeat containing 25 [ Homo sapiens ]
• Official Symbol: LRRC25
• Synonyms: LRRC25; leucine rich repeat containing 25; leucine-rich repeat-containing protein 25; FLJ38116; MAPA; monocyte and plasmacytoid-activated protein; monocyte and plasmacytoid activated molecule
• Gene ID: 126364
• mRNA Refseq: NM_145256
• Protein Refseq: NP_660299
• MIM: 607518
• UniProt ID: Q8N386