Recombinant Human LRRC41 Protein, GST-tagged
Cat.No. : | LRRC41-4666H |
Product Overview : | Human LRRC41 partial ORF ( NP_006360, 86 a.a. - 195 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | LRRC41 (Leucine Rich Repeat Containing 41) is a Protein Coding gene. Among its related pathways are Innate Immune System and Class I MHC mediated antigen processing and presentation. GO annotations related to this gene include protein homodimerization activity. |
Molecular Mass : | 37.84 kDa |
AA Sequence : | ERIEETALKKGLSTQAIWRRLWDELMKTRPSSLESVTCWRAKFMEAFFSHVLRGTIDVSSDRRLCDQRFSPLLHSSRHVRQLTICNMLQGATELVAEPNRRVLETLASSL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LRRC41 leucine rich repeat containing 41 [ Homo sapiens ] |
Official Symbol | LRRC41 |
Synonyms | LRRC41; leucine rich repeat containing 41; leucine-rich repeat-containing protein 41; MUF1; protein Muf1; MUF1 protein (MUF1); elongin BC-interacting leucine-rich repeat protein; PP7759; RP4-636H5.2; MGC126571; MGC126573; |
Gene ID | 10489 |
mRNA Refseq | NM_006369 |
Protein Refseq | NP_006360 |
UniProt ID | Q15345 |
◆ Recombinant Proteins | ||
LRRC41-4666H | Recombinant Human LRRC41 Protein, GST-tagged | +Inquiry |
LRRC41-5187M | Recombinant Mouse LRRC41 Protein, His (Fc)-Avi-tagged | +Inquiry |
LRRC41-1098H | Recombinant Human LRRC41 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Lrrc41-3832M | Recombinant Mouse Lrrc41 Protein, Myc/DDK-tagged | +Inquiry |
LRRC41-637H | Recombinant Human LRRC41, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LRRC41 Products
Required fields are marked with *
My Review for All LRRC41 Products
Required fields are marked with *
0
Inquiry Basket