Recombinant Human LRRC41 Protein, GST-tagged

Cat.No. : LRRC41-4666H
Product Overview : Human LRRC41 partial ORF ( NP_006360, 86 a.a. - 195 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : LRRC41 (Leucine Rich Repeat Containing 41) is a Protein Coding gene. Among its related pathways are Innate Immune System and Class I MHC mediated antigen processing and presentation. GO annotations related to this gene include protein homodimerization activity.
Molecular Mass : 37.84 kDa
AA Sequence : ERIEETALKKGLSTQAIWRRLWDELMKTRPSSLESVTCWRAKFMEAFFSHVLRGTIDVSSDRRLCDQRFSPLLHSSRHVRQLTICNMLQGATELVAEPNRRVLETLASSL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LRRC41 leucine rich repeat containing 41 [ Homo sapiens ]
Official Symbol LRRC41
Synonyms LRRC41; leucine rich repeat containing 41; leucine-rich repeat-containing protein 41; MUF1; protein Muf1; MUF1 protein (MUF1); elongin BC-interacting leucine-rich repeat protein; PP7759; RP4-636H5.2; MGC126571; MGC126573;
Gene ID 10489
mRNA Refseq NM_006369
Protein Refseq NP_006360
UniProt ID Q15345

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LRRC41 Products

Required fields are marked with *

My Review for All LRRC41 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon