Recombinant Human LRRC56 Protein, GST-tagged
| Cat.No. : | LRRC56-4651H |
| Product Overview : | Human LRRC56 full-length ORF ( NP_932341.1, 1 a.a. - 542 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | LRRC56 (Leucine Rich Repeat Containing 56) is a Protein Coding gene. |
| Molecular Mass : | 85.1 kDa |
| AA Sequence : | MDLGWDRSRGPRRSTSSVRVRELSWQGLHNPCPQSKGPGSQRDRLGEQLVEEYLSPARLQALARVDDLRLVRTLEMCVDTREGSLGNFGVHLPNLDQLKLNGSHLGSLRDLGTSLGHLQVLWLARCGLADLDGIASLPALKELYASYNNISDLSPLCLLEQLEVLDLEGNSVEDLGQVRYLQLCPRLAMLTLEGNLVCLQPAPGPTNKVPRGYNYRAEVRKLIPQLQVLDEVPAAHTGPPAPPRLSQDWLAVKEAIKKGNGLPPLDCPRGAPIRRLDPELSLPETQSRASRPWPFSLLVRGGPLPEGLLSEDLAPEDNTSSLTHGAGQVLCGNPTKGLRERRHQCQAREPPEQLPQHRPGDPAASTSTPEPDPADSSDFLALAGLRAWREHGVRPLPYRHPESQQEGAVAPWGPRRVPEEQVHQAEPKTPSSPPSLASEPSGTSSQHLVPSPPKHPRPRDSGSSSPRWSTDLQSRGRRLRVLGSWGPGLGDGVAAVPVLRALEVASRLSPRAQGCPGPKPAPDAAARPPRAAELSHPSPVPT |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | LRRC56 leucine rich repeat containing 56 [ Homo sapiens ] |
| Official Symbol | LRRC56 |
| Synonyms | LRRC56; leucine rich repeat containing 56 |
| Gene ID | 115399 |
| mRNA Refseq | NM_198075 |
| Protein Refseq | NP_932341 |
| UniProt ID | Q8IYG6 |
| ◆ Recombinant Proteins | ||
| LRRC56-6061HF | Recombinant Full Length Human LRRC56 Protein, GST-tagged | +Inquiry |
| LRRC56-3129R | Recombinant Rat LRRC56 Protein, His (Fc)-Avi-tagged | +Inquiry |
| LRRC56-3473R | Recombinant Rat LRRC56 Protein | +Inquiry |
| LRRC56-4651H | Recombinant Human LRRC56 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LRRC56 Products
Required fields are marked with *
My Review for All LRRC56 Products
Required fields are marked with *
