Recombinant Human LRRC57 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : LRRC57-2452H
Product Overview : LRRC57 MS Standard C13 and N15-labeled recombinant protein (NP_694992) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : LRRC57 (Leucine Rich Repeat Containing 57) is a Protein Coding gene. An important paralog of this gene is ENSG00000285942.
Molecular Mass : 26.6 kDa
AA Sequence : MGNSALRAHVETAQKTGVFQLKDRGLTEFPADLQKLTSNLRTIDLSNNKIESLPPLLIGKFTLLKSLSLNNNKLTVLPDEICNLKKLETLSLNNNHLRELPSTFGQLSALKTLSLSGNQLGALPPQLCSLRHLDVMDLSKNQIRSIPDSVGELQVIELNLNQNQISQISVKISCCPRLKILRLEENCLELSMLPQSILSDSQICLLAVEGNLFEIKKLRELEGYDKYMERFTATKKKFATRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name LRRC57 leucine rich repeat containing 57 [ Homo sapiens (human) ]
Official Symbol LRRC57
Synonyms LRRC57; leucine rich repeat containing 57; leucine-rich repeat-containing protein 57; FLJ36812; DKFZp686H1865;
Gene ID 255252
mRNA Refseq NM_153260
Protein Refseq NP_694992
UniProt ID Q8N9N7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LRRC57 Products

Required fields are marked with *

My Review for All LRRC57 Products

Required fields are marked with *

0
cart-icon