Recombinant Human LRRC57 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | LRRC57-2452H |
| Product Overview : | LRRC57 MS Standard C13 and N15-labeled recombinant protein (NP_694992) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | LRRC57 (Leucine Rich Repeat Containing 57) is a Protein Coding gene. An important paralog of this gene is ENSG00000285942. |
| Molecular Mass : | 26.6 kDa |
| AA Sequence : | MGNSALRAHVETAQKTGVFQLKDRGLTEFPADLQKLTSNLRTIDLSNNKIESLPPLLIGKFTLLKSLSLNNNKLTVLPDEICNLKKLETLSLNNNHLRELPSTFGQLSALKTLSLSGNQLGALPPQLCSLRHLDVMDLSKNQIRSIPDSVGELQVIELNLNQNQISQISVKISCCPRLKILRLEENCLELSMLPQSILSDSQICLLAVEGNLFEIKKLRELEGYDKYMERFTATKKKFATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | LRRC57 leucine rich repeat containing 57 [ Homo sapiens (human) ] |
| Official Symbol | LRRC57 |
| Synonyms | LRRC57; leucine rich repeat containing 57; leucine-rich repeat-containing protein 57; FLJ36812; DKFZp686H1865; |
| Gene ID | 255252 |
| mRNA Refseq | NM_153260 |
| Protein Refseq | NP_694992 |
| UniProt ID | Q8N9N7 |
| ◆ Recombinant Proteins | ||
| LRRC57-2383R | Recombinant Rhesus Macaque LRRC57 Protein, His (Fc)-Avi-tagged | +Inquiry |
| LRRC57-4650H | Recombinant Human LRRC57 Protein, GST-tagged | +Inquiry |
| LRRC57-3130R | Recombinant Rat LRRC57 Protein, His (Fc)-Avi-tagged | +Inquiry |
| LRRC57-2563R | Recombinant Rhesus monkey LRRC57 Protein, His-tagged | +Inquiry |
| Lrrc57-3838M | Recombinant Mouse Lrrc57 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LRRC57-1033HCL | Recombinant Human LRRC57 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LRRC57 Products
Required fields are marked with *
My Review for All LRRC57 Products
Required fields are marked with *
