Recombinant Human LRRC8A Protein, GST-tagged
| Cat.No. : | LRRC8A-4646H |
| Product Overview : | Human LRRC8A partial ORF ( NP_062540.2, 711 a.a. - 810 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a protein belonging to the leucine-rich repeat family of proteins, which are involved in diverse biological processes, including cell adhesion, cellular trafficking, and hormone-receptor interactions. This family member is a putative four-pass transmembrane protein that plays a role in B cell development. Defects in this gene cause autosomal dominant non-Bruton type agammaglobulinemia, an immunodeficiency disease resulting from defects in B cell maturation. Multiple alternatively spliced transcript variants, which encode the same protein, have been identified for this gene. [provided by RefSeq |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | QNLAITANRIETLPPELFQCRKLRALHLGNNVLQSLPSRVGELTNLTQIELRGNRLECLPVELGECPLLKRSGLVVEEDLFNTLPPEVKERLWRADKEQA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | LRRC8A leucine rich repeat containing 8 VRAC subunit A [ Homo sapiens (human) ] |
| Official Symbol | LRRC8A |
| Synonyms | LRRC8A; leucine rich repeat containing 8 VRAC subunit A; AGM5; LRRC8; SWELL1; volume-regulated anion channel subunit LRRC8A; leucine rich repeat containing 8 family member A; leucine-rich repeat-containing protein 8A; swelling protein 1 |
| Gene ID | https://www.ncbi.nlm.nih.gov/gene/?term=56262 |
| mRNA Refseq | NM_001127244 |
| Protein Refseq | NP_001120716 |
| MIM | 608360 |
| UniProt ID | Q8IWT6 |
| ◆ Recombinant Proteins | ||
| LRRC8A-5202M | Recombinant Mouse LRRC8A Protein, His (Fc)-Avi-tagged | +Inquiry |
| LRRC8A-2386R | Recombinant Rhesus Macaque LRRC8A Protein, His (Fc)-Avi-tagged | +Inquiry |
| Lrrc8a-3844M | Recombinant Mouse Lrrc8a Protein, Myc/DDK-tagged | +Inquiry |
| LRRC8A-9296M | Recombinant Mouse LRRC8A Protein | +Inquiry |
| LRRC8A-3180Z | Recombinant Zebrafish LRRC8A | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LRRC8A Products
Required fields are marked with *
My Review for All LRRC8A Products
Required fields are marked with *
