Recombinant Human LRRIQ3 Protein, GST-tagged
Cat.No. : | LRRIQ3-4663H |
Product Overview : | Human LRRC44 full-length ORF ( NP_660301.1, 1 a.a. - 199 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | LRRIQ3 (Leucine Rich Repeats And IQ Motif Containing 3) is a Protein Coding gene. |
Molecular Mass : | 49.6 kDa |
AA Sequence : | MFHGTVTEELTSHEEWSHYNENIREGQKDFVFVKFNGLHLKSMENLQSCISLRVCIFSNNFITDIHPLQSCIKLIKLDLHGNQIKSLPNTKFWNGLKNLKLLYLHDNGFAKLKNICVLSACPTLIALTMFDCPVSLKKGYRHVLVNSIWPLKALDHHVISDEEIIQNWHLPERFKACNHRLFFNFCPALRKEKMKHSEV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LRRIQ3 leucine rich repeats and IQ motif containing 3 [ Homo sapiens (human) ] |
Official Symbol | LRRIQ3 |
Synonyms | LRRIQ3; leucine rich repeats and IQ motif containing 3; LRRC44; leucine-rich repeat and IQ domain-containing protein 3; leucine rich repeat containing 44; leucine-rich repeat-containing protein 44 |
Gene ID | 127255 |
mRNA Refseq | NM_001105659 |
Protein Refseq | NP_001099129 |
UniProt ID | A6PVS8 |
◆ Recombinant Proteins | ||
LRRIQ3-9307M | Recombinant Mouse LRRIQ3 Protein | +Inquiry |
LRRIQ3-4663H | Recombinant Human LRRIQ3 Protein, GST-tagged | +Inquiry |
LRRIQ3-3141R | Recombinant Rat LRRIQ3 Protein, His (Fc)-Avi-tagged | +Inquiry |
LRRIQ3-3485R | Recombinant Rat LRRIQ3 Protein | +Inquiry |
LRRIQ3-5210M | Recombinant Mouse LRRIQ3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LRRIQ3-1031HCL | Recombinant Human LRRIQ3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LRRIQ3 Products
Required fields are marked with *
My Review for All LRRIQ3 Products
Required fields are marked with *
0
Inquiry Basket