Recombinant Human LRRK2 Protein, GST-tagged
Cat.No. : | LRRK2-4634H |
Product Overview : | Human LRRK2 partial ORF ( AAV63975, 2161 a.a. - 2260 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of the leucine-rich repeat kinase family and encodes a protein with an ankryin repeat region, a leucine-rich repeat (LRR) domain, a kinase domain, a DFG-like motif, a RAS domain, a GTPase domain, a MLK-like domain, and a WD40 domain. The protein is present largely in the cytoplasm but also associates with the mitochondrial outer membrane. Mutations in this gene have been associated with Parkinson disease-8. [provided by RefSeq |
Molecular Mass : | 36.63 kDa |
AA Sequence : | NSRNASIWLGCGHTDRGQLSFLDLNTEGYTSEEVADSRILCLALVHLPVEKESWIVSGTQSGTLLVINTEDGKKRHTLEKMTDSVTCLYCNSFSKQSKQK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LRRK2 leucine-rich repeat kinase 2 [ Homo sapiens ] |
Official Symbol | LRRK2 |
Synonyms | LRRK2; leucine-rich repeat kinase 2; PARK8, Parkinson disease (autosomal dominant) 8; leucine-rich repeat serine/threonine-protein kinase 2; DKFZp434H2111; FLJ45829; RIPK7; ROCO2; augmented in rheumatoid arthritis 17; PARK8; AURA17; DARDARIN; |
Gene ID | 120892 |
mRNA Refseq | NM_198578 |
Protein Refseq | NP_940980 |
MIM | 609007 |
UniProt ID | Q5S007 |
◆ Recombinant Proteins | ||
LRRK2-4634H | Recombinant Human LRRK2 Protein, GST-tagged | +Inquiry |
LRRK2-1320H | Recombinant Human LRRK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
LRRK2-115H | Active Recombinant Human LRRK2 (Y1699C) Protein, GST-tagged | +Inquiry |
LRRK2-108H | Active Recombinant Human LRRK2 (G2019S), GST-tagged | +Inquiry |
LRRK2-1553H | Recombinant Human LRRK2 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LRRK2 Products
Required fields are marked with *
My Review for All LRRK2 Products
Required fields are marked with *