Recombinant Human LRRK2 Protein, GST-tagged

Cat.No. : LRRK2-4634H
Product Overview : Human LRRK2 partial ORF ( AAV63975, 2161 a.a. - 2260 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is a member of the leucine-rich repeat kinase family and encodes a protein with an ankryin repeat region, a leucine-rich repeat (LRR) domain, a kinase domain, a DFG-like motif, a RAS domain, a GTPase domain, a MLK-like domain, and a WD40 domain. The protein is present largely in the cytoplasm but also associates with the mitochondrial outer membrane. Mutations in this gene have been associated with Parkinson disease-8. [provided by RefSeq
Molecular Mass : 36.63 kDa
AA Sequence : NSRNASIWLGCGHTDRGQLSFLDLNTEGYTSEEVADSRILCLALVHLPVEKESWIVSGTQSGTLLVINTEDGKKRHTLEKMTDSVTCLYCNSFSKQSKQK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LRRK2 leucine-rich repeat kinase 2 [ Homo sapiens ]
Official Symbol LRRK2
Synonyms LRRK2; leucine-rich repeat kinase 2; PARK8, Parkinson disease (autosomal dominant) 8; leucine-rich repeat serine/threonine-protein kinase 2; DKFZp434H2111; FLJ45829; RIPK7; ROCO2; augmented in rheumatoid arthritis 17; PARK8; AURA17; DARDARIN;
Gene ID 120892
mRNA Refseq NM_198578
Protein Refseq NP_940980
MIM 609007
UniProt ID Q5S007

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LRRK2 Products

Required fields are marked with *

My Review for All LRRK2 Products

Required fields are marked with *

0
cart-icon