Recombinant Human LRRN2, His-tagged
Cat.No. : | LRRN2-29432TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 333-549 of Human LRRN5 with N terminal His tag; MWt 25 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 333-549 a.a. |
Description : | The protein encoded by this gene belongs to the leucine-rich repeat superfamily. This gene was found to be amplified and overexpressed in malignant gliomas. The encoded protein has homology with other proteins that function as cell-adhesion molecules or as signal transduction receptors and is a candidate for the target gene in the 1q32.1 amplicon in malignant gliomas. Two alternatively spliced transcript variants encoding the same protein have been described for this gene. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 115 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | HLPQMETLMLNNNALSALHQQTVESLPNLQEVGLHGNPIR CDCVIRWANATGTRVRFIEPQSTLCAEPPDLQRLPVRE VPFREMTDHCLPLISPRSFPPSLQVASGESMVLHCRAL AEPEPEIYWVTPAGLRLTPAHAGRRYRVYPEGTLELRRVTAEEAGLYTCVAQNLVGADTKTVSVVVGRALLQPGRDEG QGLELRVQETHPYHILLSWVTPP |
Gene Name | LRRN2 leucine rich repeat neuronal 2 [ Homo sapiens ] |
Official Symbol | LRRN2 |
Synonyms | LRRN2; leucine rich repeat neuronal 2; leucine rich repeat neuronal 5 , LRRN5; leucine-rich repeat neuronal protein 2; fibronectin type III; immunoglobulin and leucine rich repeat domain 7; FIGLER7; GAC1; leucine rich and ankyrin repeats 1; LRANK1; |
Gene ID | 10446 |
mRNA Refseq | NM_006338 |
Protein Refseq | NP_006329 |
MIM | 605492 |
Uniprot ID | O75325 |
Chromosome Location | 1q32.1 |
Function | receptor activity; |
◆ Recombinant Proteins | ||
LRRN2-4631H | Recombinant Human LRRN2 Protein, GST-tagged | +Inquiry |
RFL5342HF | Recombinant Full Length Human Leucine-Rich Repeat Neuronal Protein 2(Lrrn2) Protein, His-Tagged | +Inquiry |
LRRN2-29432TH | Recombinant Human LRRN2, His-tagged | +Inquiry |
LRRN2-6081HF | Recombinant Full Length Human LRRN2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LRRN2-4618HCL | Recombinant Human LRRN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LRRN2 Products
Required fields are marked with *
My Review for All LRRN2 Products
Required fields are marked with *
0
Inquiry Basket