Recombinant Human LRRTM1 Protein
Cat.No. : | LRRTM1-4628H |
Product Overview : | Human LRRTM1 full-length ORF (ADR82640.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Description : | LRRTM1 (Leucine Rich Repeat Transmembrane Neuronal 1) is a Protein Coding gene. Diseases associated with LRRTM1 include Schizophrenia and Autism Spectrum Disorder. Among its related pathways are Protein-protein interactions at synapses and Transmission across Chemical Synapses. An important paralog of this gene is LRRTM2. |
Form : | Liquid |
Molecular Mass : | 57.5 kDa |
AA Sequence : | MDFLLLGLCLYWLLRRPSGVVLCLLGACFQMLPAAPSGCPQLCRCEGRLLYCEALNLTEAPHNLSGLLGLSLRYNSLSELRAGQFTGLMQLTWLYLDHNHICSVQGDAFQKLRRVKELTLSSNQITQLPNTTFRPMPNLRSVDLSYNKLQALAPDLFHGLRKLTTLHMRANAIQFVPVRIFQDCRSLKFLDIGYNQLKSLARNSFAGLFKLTELHLEHNDLVKVNFAHFPRLISLHSLCLRRNKVAIVVSSLDWVWNLEKMDLSGNEIEYMEPHVFETVPHLQSLQLDSNRLTYIEPRILNSWKSLTSITLAGNLWDCGRNVCALASWLSNFQGRYDGNLQCASPEYAQGEDVLDAVYAFHLCEDGAEPTSGHLLSAVTNRSDLGPPASSATTLADGGEGQHDGTFEPATVALPGGEHAENAVQIHKVVTGTMALIFSFLIVVLVLYVSWKCFPASLRQLRQCFVTQRRKQKQKQTMHQMAAMSAQEYYVDYKPNHIEGALVIINEYGSCTCHQQPARECEV |
Applications : | Antibody Production Functional Study Compound Screening |
Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | LRRTM1 leucine rich repeat transmembrane neuronal 1 [ Homo sapiens ] |
Official Symbol | LRRTM1 |
Synonyms | LRRTM1; leucine rich repeat transmembrane neuronal 1; leucine-rich repeat transmembrane neuronal protein 1; FLJ32082; leucine-rich repeat transmembrane neuronal 1 protein; |
Gene ID | 347730 |
mRNA Refseq | NM_178839 |
Protein Refseq | NP_849161 |
MIM | 610867 |
UniProt ID | Q86UE6 |
◆ Recombinant Proteins | ||
LRRTM1-6107HF | Recombinant Full Length Human LRRTM1 Protein | +Inquiry |
LRRTM1-3488R | Recombinant Rat LRRTM1 Protein | +Inquiry |
LRRTM1-9315M | Recombinant Mouse LRRTM1 Protein | +Inquiry |
LRRTM1-5216M | Recombinant Mouse LRRTM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
LRRTM1-2392R | Recombinant Rhesus Macaque LRRTM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LRRTM1-4617HCL | Recombinant Human LRRTM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LRRTM1 Products
Required fields are marked with *
My Review for All LRRTM1 Products
Required fields are marked with *
0
Inquiry Basket