Recombinant Human LRRTM1 Protein
| Cat.No. : | LRRTM1-4628H |
| Product Overview : | Human LRRTM1 full-length ORF (ADR82640.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Description : | LRRTM1 (Leucine Rich Repeat Transmembrane Neuronal 1) is a Protein Coding gene. Diseases associated with LRRTM1 include Schizophrenia and Autism Spectrum Disorder. Among its related pathways are Protein-protein interactions at synapses and Transmission across Chemical Synapses. An important paralog of this gene is LRRTM2. |
| Form : | Liquid |
| Molecular Mass : | 57.5 kDa |
| AA Sequence : | MDFLLLGLCLYWLLRRPSGVVLCLLGACFQMLPAAPSGCPQLCRCEGRLLYCEALNLTEAPHNLSGLLGLSLRYNSLSELRAGQFTGLMQLTWLYLDHNHICSVQGDAFQKLRRVKELTLSSNQITQLPNTTFRPMPNLRSVDLSYNKLQALAPDLFHGLRKLTTLHMRANAIQFVPVRIFQDCRSLKFLDIGYNQLKSLARNSFAGLFKLTELHLEHNDLVKVNFAHFPRLISLHSLCLRRNKVAIVVSSLDWVWNLEKMDLSGNEIEYMEPHVFETVPHLQSLQLDSNRLTYIEPRILNSWKSLTSITLAGNLWDCGRNVCALASWLSNFQGRYDGNLQCASPEYAQGEDVLDAVYAFHLCEDGAEPTSGHLLSAVTNRSDLGPPASSATTLADGGEGQHDGTFEPATVALPGGEHAENAVQIHKVVTGTMALIFSFLIVVLVLYVSWKCFPASLRQLRQCFVTQRRKQKQKQTMHQMAAMSAQEYYVDYKPNHIEGALVIINEYGSCTCHQQPARECEV |
| Applications : | Antibody Production Functional Study Compound Screening |
| Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene Name | LRRTM1 leucine rich repeat transmembrane neuronal 1 [ Homo sapiens ] |
| Official Symbol | LRRTM1 |
| Synonyms | LRRTM1; leucine rich repeat transmembrane neuronal 1; leucine-rich repeat transmembrane neuronal protein 1; FLJ32082; leucine-rich repeat transmembrane neuronal 1 protein; |
| Gene ID | 347730 |
| mRNA Refseq | NM_178839 |
| Protein Refseq | NP_849161 |
| MIM | 610867 |
| UniProt ID | Q86UE6 |
| ◆ Cell & Tissue Lysates | ||
| LRRTM1-4617HCL | Recombinant Human LRRTM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LRRTM1 Products
Required fields are marked with *
My Review for All LRRTM1 Products
Required fields are marked with *




