Recombinant Human LSM1 Protein, GST-tagged
Cat.No. : | LSM1-4618H |
Product Overview : | Human LSM1 full-length ORF ( AAH01767, 1 a.a. - 133 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM |
Molecular Mass : | 40.37 kDa |
AA Sequence : | MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LSM1 LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | LSM1 |
Synonyms | LSM1; LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae); U6 snRNA-associated Sm-like protein LSm1; CASM; YJL124C; small nuclear ribonuclear CaSm; cancer-associated Sm-like protein; |
Gene ID | 27257 |
mRNA Refseq | NM_014462 |
Protein Refseq | NP_055277 |
MIM | 607281 |
UniProt ID | O15116 |
◆ Recombinant Proteins | ||
LSM1-3006H | Recombinant Human LSM1 Homolog, U6 Small Nuclear RNA Associated (S. Cerevisiae), T7-tagged | +Inquiry |
LSM1-4618H | Recombinant Human LSM1 Protein, GST-tagged | +Inquiry |
LSM1-2818H | Recombinant Human LSM1, His-tagged | +Inquiry |
LSM1-331H | Recombinant Human LSM1 protein(Met1-Tyr133), His-tagged | +Inquiry |
LSM1-985Z | Recombinant Zebrafish LSM1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
LSM1-4613HCL | Recombinant Human LSM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LSM1 Products
Required fields are marked with *
My Review for All LSM1 Products
Required fields are marked with *
0
Inquiry Basket