Recombinant Human LSM1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : LSM1-618H
Product Overview : LSM1 MS Standard C13 and N15-labeled recombinant protein (NP_055277) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the LSm family of RNA-binding proteins. LSm proteins form stable heteromers that bind specifically to the 3'-terminal oligo(U) tract of U6 snRNA and may play a role in pre-mRNA splicing by mediating U4/U6 snRNP formation. Increased expression of this gene may play a role in cellular transformation and the progression of several malignancies including lung cancer, mesothelioma and breast cancer. Alternatively spliced transcript variants have been observed for this gene, and a pseudogene of this gene is located on the short arm of chromosome 9.
Molecular Mass : 15.2 kDa
AA Sequence : MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEYTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name LSM1 LSM1 homolog, mRNA degradation associated [ Homo sapiens (human) ]
Official Symbol LSM1
Synonyms LSM1; LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae); U6 snRNA-associated Sm-like protein LSm1; CASM; YJL124C; small nuclear ribonuclear CaSm; cancer-associated Sm-like protein;
Gene ID 27257
mRNA Refseq NM_014462
Protein Refseq NP_055277
MIM 607281
UniProt ID O15116

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LSM1 Products

Required fields are marked with *

My Review for All LSM1 Products

Required fields are marked with *

0
cart-icon
0
compare icon