Recombinant Human LSM1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: LSM1-618H
• Product Overview: LSM1 MS Standard C13 and N15-labeled recombinant protein (NP_055277) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a member of the LSm family of RNA-binding proteins. LSm proteins form stable heteromers that bind specifically to the 3'-terminal oligo(U) tract of U6 snRNA and may play a role in pre-mRNA splicing by mediating U4/U6 snRNP formation. Increased expression of this gene may play a role in cellular transformation and the progression of several malignancies including lung cancer, mesothelioma and breast cancer. Alternatively spliced transcript variants have been observed for this gene, and a pseudogene of this gene is located on the short arm of chromosome 9.
• Molecular Mass: 15.2 kDa
• AA Sequence: MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEYTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: LSM1 LSM1 homolog, mRNA degradation associated [ Homo sapiens (human) ]
• Official Symbol: LSM1
• Synonyms: LSM1; LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae); U6 snRNA-associated Sm-like protein LSm1; CASM; YJL124C; small nuclear ribonuclear CaSm; cancer-associated Sm-like protein
• Gene ID: 27257
• mRNA Refseq: NM_014462
• Protein Refseq: NP_055277
• MIM: 607281
• UniProt ID: O15116