Recombinant Human LSM1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | LSM1-618H |
Product Overview : | LSM1 MS Standard C13 and N15-labeled recombinant protein (NP_055277) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the LSm family of RNA-binding proteins. LSm proteins form stable heteromers that bind specifically to the 3'-terminal oligo(U) tract of U6 snRNA and may play a role in pre-mRNA splicing by mediating U4/U6 snRNP formation. Increased expression of this gene may play a role in cellular transformation and the progression of several malignancies including lung cancer, mesothelioma and breast cancer. Alternatively spliced transcript variants have been observed for this gene, and a pseudogene of this gene is located on the short arm of chromosome 9. |
Molecular Mass : | 15.2 kDa |
AA Sequence : | MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | LSM1 LSM1 homolog, mRNA degradation associated [ Homo sapiens (human) ] |
Official Symbol | LSM1 |
Synonyms | LSM1; LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae); U6 snRNA-associated Sm-like protein LSm1; CASM; YJL124C; small nuclear ribonuclear CaSm; cancer-associated Sm-like protein; |
Gene ID | 27257 |
mRNA Refseq | NM_014462 |
Protein Refseq | NP_055277 |
MIM | 607281 |
UniProt ID | O15116 |
◆ Recombinant Proteins | ||
LSM1-4202H | Recombinant Human LSM1 Protein (Met1-Tyr133), C-His tagged | +Inquiry |
Lsm1-3852M | Recombinant Mouse Lsm1 Protein, Myc/DDK-tagged | +Inquiry |
LSM1-331H | Recombinant Human LSM1 protein(Met1-Tyr133), His-tagged | +Inquiry |
LSM1-4618H | Recombinant Human LSM1 Protein, GST-tagged | +Inquiry |
LSM1-3006H | Recombinant Human LSM1 Homolog, U6 Small Nuclear RNA Associated (S. Cerevisiae), T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LSM1-4613HCL | Recombinant Human LSM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LSM1 Products
Required fields are marked with *
My Review for All LSM1 Products
Required fields are marked with *
0
Inquiry Basket