Recombinant Human LSM10 Protein (1-123 aa), His-SUMO-tagged
| Cat.No. : | LSM10-1073H |
| Product Overview : | Recombinant Human LSM10 Protein (1-123 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Transcription. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-123 aa |
| Description : | Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Increases U7 snRNA levels but not histone 3'-end pre-mRNA processing activity, when overexpressed. Required for cell cycle progression from G1 to S phases. Binds specifically to U7 snRNA. Binds to the downstream cleavage product (DCP) of histone pre-mRNA in a U7 snRNP dependent manner. |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 30.1 kDa |
| AA Sequence : | MAVSHSVKERTISENSLIILLQGLQGRVTTVDLRDESVAHGRIDNVDAFMNIRLAKVTYTDRWGHQVKLDDLFVTGRNVRYVHIPDDVNITSTIEQQLQIIHRVRNFGGKGQGRWEFPPKNCK |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | LSM10 LSM10, U7 small nuclear RNA associated [ Homo sapiens ] |
| Official Symbol | LSM10 |
| Synonyms | LSM10; MGC15749; MST074; MSTP074; |
| Gene ID | 84967 |
| mRNA Refseq | NM_032881 |
| Protein Refseq | NP_116270 |
| UniProt ID | Q969L4 |
| ◆ Recombinant Proteins | ||
| LSM10-2398R | Recombinant Rhesus Macaque LSM10 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Lsm10-574M | Recombinant Mouse Lsm10 Protein, MYC/DDK-tagged | +Inquiry |
| LSM10-1646H | Recombinant Human LSM10 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| LSM10-2578R | Recombinant Rhesus monkey LSM10 Protein, His-tagged | +Inquiry |
| LSM10-1073H | Recombinant Human LSM10 Protein (1-123 aa), His-SUMO-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LSM10-4612HCL | Recombinant Human LSM10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LSM10 Products
Required fields are marked with *
My Review for All LSM10 Products
Required fields are marked with *
