Recombinant Human LSM10 Protein (1-123 aa), His-SUMO-tagged

Cat.No. : LSM10-1073H
Product Overview : Recombinant Human LSM10 Protein (1-123 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Transcription. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 1-123 aa
Description : Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Increases U7 snRNA levels but not histone 3'-end pre-mRNA processing activity, when overexpressed. Required for cell cycle progression from G1 to S phases. Binds specifically to U7 snRNA. Binds to the downstream cleavage product (DCP) of histone pre-mRNA in a U7 snRNP dependent manner.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 30.1 kDa
AA Sequence : MAVSHSVKERTISENSLIILLQGLQGRVTTVDLRDESVAHGRIDNVDAFMNIRLAKVTYTDRWGHQVKLDDLFVTGRNVRYVHIPDDVNITSTIEQQLQIIHRVRNFGGKGQGRWEFPPKNCK
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name LSM10 LSM10, U7 small nuclear RNA associated [ Homo sapiens ]
Official Symbol LSM10
Synonyms LSM10; MGC15749; MST074; MSTP074;
Gene ID 84967
mRNA Refseq NM_032881
Protein Refseq NP_116270
UniProt ID Q969L4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LSM10 Products

Required fields are marked with *

My Review for All LSM10 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon