Recombinant Human LSM10 Protein (1-123 aa), His-SUMO-tagged
Cat.No. : | LSM10-1073H |
Product Overview : | Recombinant Human LSM10 Protein (1-123 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Transcription. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-123 aa |
Description : | Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Increases U7 snRNA levels but not histone 3'-end pre-mRNA processing activity, when overexpressed. Required for cell cycle progression from G1 to S phases. Binds specifically to U7 snRNA. Binds to the downstream cleavage product (DCP) of histone pre-mRNA in a U7 snRNP dependent manner. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 30.1 kDa |
AA Sequence : | MAVSHSVKERTISENSLIILLQGLQGRVTTVDLRDESVAHGRIDNVDAFMNIRLAKVTYTDRWGHQVKLDDLFVTGRNVRYVHIPDDVNITSTIEQQLQIIHRVRNFGGKGQGRWEFPPKNCK |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | LSM10 LSM10, U7 small nuclear RNA associated [ Homo sapiens ] |
Official Symbol | LSM10 |
Synonyms | LSM10; MGC15749; MST074; MSTP074; |
Gene ID | 84967 |
mRNA Refseq | NM_032881 |
Protein Refseq | NP_116270 |
UniProt ID | Q969L4 |
◆ Recombinant Proteins | ||
LSM10-1646H | Recombinant Human LSM10 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
LSM10-2398R | Recombinant Rhesus Macaque LSM10 Protein, His (Fc)-Avi-tagged | +Inquiry |
Lsm10-574M | Recombinant Mouse Lsm10 Protein, MYC/DDK-tagged | +Inquiry |
LSM10-2578R | Recombinant Rhesus monkey LSM10 Protein, His-tagged | +Inquiry |
LSM10-1073H | Recombinant Human LSM10 Protein (1-123 aa), His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LSM10-4612HCL | Recombinant Human LSM10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LSM10 Products
Required fields are marked with *
My Review for All LSM10 Products
Required fields are marked with *
0
Inquiry Basket