Recombinant Human LSM14A Protein, His-tagged
| Cat.No. : | LSM14A-40H |
| Product Overview : | Recombinant Human LSM14A Protein(Q8ND56)(41-330 aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 41-330 aa |
| Form : | Phosphate buffered saline |
| Molecular Mass : | 33 kDa |
| AASequence : | VRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCEPPKPQCSLPQDPAIVQSSLGSSTSSFQSMGSYGPFGRMPTYSQFSPSSLVGQQFGAVGVAGSSLTSFGTETSNSGTLPQSSAVGSAFTQDTRSLKTQLSQGRSSPQLDPLRKSPTMEQAVQTASAHLPAPAAVGRRSPVSTRPLPSASQKAGENQEHRRAEVHKVSRPENEQLRNDNKRQVAPGAPSAPRRGRGGHRGGRGRFGIRRDGPMKFEKDFDFESANAQFNKEEIDREFHNKLKLKEDKLEKQEK |
| Storage : | Store at -20°C to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | LSM14A LSM14A, SCD6 homolog A (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | LSM14A |
| Synonyms | LSM14A; LSM14A, SCD6 homolog A (S. cerevisiae); C19orf13, chromosome 19 open reading frame 13 , FAM61A, family with sequence similarity 61, member A , LSM14 homolog A (SCD6, S. cerevisiae); protein LSM14 homolog A; DKFZP434D1335; RAP55; RAP55A; hRAP55; hRAP55A; alphaSNBP; LSM14 homolog A; protein SCD6 homolog; RNA-associated protein 55; RNA-associated protein 55A; putative alpha-synuclein-binding protein; family with sequence similarity 61, member A; FAM61A; C19orf13; DKFZp434D1335; |
| Gene ID | 26065 |
| mRNA Refseq | NM_001114093 |
| Protein Refseq | NP_001107565 |
| MIM | 610677 |
| UniProt ID | Q8ND56 |
| ◆ Recombinant Proteins | ||
| LSM14A-3036H | Recombinant Human LSM14A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| LSM14A-5160H | Recombinant Human LSM14A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| LSM14A-40H | Recombinant Human LSM14A Protein, His-tagged | +Inquiry |
| LSM14A-6137HF | Recombinant Full Length Human LSM14A Protein, GST-tagged | +Inquiry |
| LSM14A-2400R | Recombinant Rhesus Macaque LSM14A Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LSM14A-4609HCL | Recombinant Human LSM14A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LSM14A Products
Required fields are marked with *
My Review for All LSM14A Products
Required fields are marked with *



