Recombinant Human LSM14A Protein, His-tagged

• Cat.No.: LSM14A-41H
• Product Overview: Recombinant Human LSM14A Protein(108-219 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 108-219 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AASequence: MGSYGPFGRMPTYSQFSPSSLVGQQFGAVGVAGSSLTSFGTETSNSGTLPQSSAVGSAFTQDTRSLKTQLSQGRSSPQLDPLRKSPTMEQAVQTASAHLPAPAAVGRRSPVS
• Purity: 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: LSM14A LSM14A, SCD6 homolog A (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: LSM14A
• Synonyms: LSM14A; LSM14A, SCD6 homolog A (S. cerevisiae); C19orf13, chromosome 19 open reading frame 13 , FAM61A, family with sequence similarity 61, member A , LSM14 homolog A (SCD6, S. cerevisiae); protein LSM14 homolog A; DKFZP434D1335; RAP55; RAP55A; hRAP55; hRAP55A; alphaSNBP; LSM14 homolog A; protein SCD6 homolog; RNA-associated protein 55; RNA-associated protein 55A; putative alpha-synuclein-binding protein; family with sequence similarity 61, member A; FAM61A; C19orf13; DKFZp434D1335
• Gene ID: 26065
• mRNA Refseq: NM_001114093
• Protein Refseq: NP_001107565
• MIM: 610677
• UniProt ID: Q8ND56