Recombinant Human LSM14A Protein, His-tagged
| Cat.No. : | LSM14A-41H |
| Product Overview : | Recombinant Human LSM14A Protein(108-219 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 108-219 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AASequence : | MGSYGPFGRMPTYSQFSPSSLVGQQFGAVGVAGSSLTSFGTETSNSGTLPQSSAVGSAFTQDTRSLKTQLSQGRSSPQLDPLRKSPTMEQAVQTASAHLPAPAAVGRRSPVS |
| Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| Gene Name | LSM14A LSM14A, SCD6 homolog A (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | LSM14A |
| Synonyms | LSM14A; LSM14A, SCD6 homolog A (S. cerevisiae); C19orf13, chromosome 19 open reading frame 13 , FAM61A, family with sequence similarity 61, member A , LSM14 homolog A (SCD6, S. cerevisiae); protein LSM14 homolog A; DKFZP434D1335; RAP55; RAP55A; hRAP55; hRAP55A; alphaSNBP; LSM14 homolog A; protein SCD6 homolog; RNA-associated protein 55; RNA-associated protein 55A; putative alpha-synuclein-binding protein; family with sequence similarity 61, member A; FAM61A; C19orf13; DKFZp434D1335; |
| Gene ID | 26065 |
| mRNA Refseq | NM_001114093 |
| Protein Refseq | NP_001107565 |
| MIM | 610677 |
| UniProt ID | Q8ND56 |
| ◆ Recombinant Proteins | ||
| LSM14A-3036H | Recombinant Human LSM14A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| LSM14A-40H | Recombinant Human LSM14A Protein, His-tagged | +Inquiry |
| LSM14A-2007C | Recombinant Chicken LSM14A | +Inquiry |
| LSM14A-6137HF | Recombinant Full Length Human LSM14A Protein, GST-tagged | +Inquiry |
| LSM14A-2400R | Recombinant Rhesus Macaque LSM14A Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LSM14A-4609HCL | Recombinant Human LSM14A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LSM14A Products
Required fields are marked with *
My Review for All LSM14A Products
Required fields are marked with *



