Recombinant Human LSM4 protein, GST-tagged
| Cat.No. : | LSM4-1867H |
| Product Overview : | Recombinant Human LSM4 protein(1-139 aa), fused to GST tag, was expressed in E. coli. |
| Availability | November 04, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-139 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVKEEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKQ |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | LSM4 LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | LSM4 |
| Synonyms | LSM4; LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae); U6 snRNA-associated Sm-like protein LSm4; YER112W; glycine-rich protein; GRP; |
| Gene ID | 25804 |
| mRNA Refseq | NM_001252129 |
| Protein Refseq | NP_001239058 |
| MIM | 607284 |
| UniProt ID | Q9Y4Z0 |
| ◆ Recombinant Proteins | ||
| LSM4-3185H | Recombinant Human LSM4 protein, His-SUMO-tagged | +Inquiry |
| LSM4-5997HF | Recombinant Full Length Human LSM4 Protein, GST-tagged | +Inquiry |
| LSM4-188H | Recombinant Human LSM4 Protein, His-tagged | +Inquiry |
| LSM4-1867H | Recombinant Human LSM4 protein, GST-tagged | +Inquiry |
| LSM4-4170H | Recombinant Human LSM4 Protein (Met1-Gln139), N-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LSM4-9173HCL | Recombinant Human LSM4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LSM4 Products
Required fields are marked with *
My Review for All LSM4 Products
Required fields are marked with *
