Recombinant Human LSM5 protein, GST-tagged
Cat.No. : | LSM5-654H |
Product Overview : | Recombinant Human LSM5 protein(1-91 aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | August 03, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | GST |
Protein Length : | 1-91 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | MAANATTNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLVPGGEGPEV |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | LSM5 LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | LSM5 |
Synonyms | LSM5; LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae); U6 snRNA-associated Sm-like protein LSm5; YER146W; FLJ12710; |
mRNA Refseq | NM_001130710 |
Protein Refseq | NP_001124182 |
MIM | 607285 |
UniProt ID | Q9Y4Y9 |
Gene ID | 23658 |
◆ Recombinant Proteins | ||
LSM5-5227M | Recombinant Mouse LSM5 Protein, His (Fc)-Avi-tagged | +Inquiry |
LSM5-2585R | Recombinant Rhesus monkey LSM5 Protein, His-tagged | +Inquiry |
LSM5-654H | Recombinant Human LSM5 protein, GST-tagged | +Inquiry |
LSM5-9334M | Recombinant Mouse LSM5 Protein | +Inquiry |
LSM5-5643C | Recombinant Chicken LSM5 | +Inquiry |
◆ Cell & Tissue Lysates | ||
LSM5-9172HCL | Recombinant Human LSM5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LSM5 Products
Required fields are marked with *
My Review for All LSM5 Products
Required fields are marked with *