Recombinant Human LSM6 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | LSM6-4654H |
| Product Overview : | LSM6 MS Standard C13 and N15-labeled recombinant protein (NP_009011) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing. |
| Molecular Mass : | 9.1 kDa |
| AA Sequence : | MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRRMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | LSM6 LSM6 homolog, U6 small nuclear RNA and mRNA degradation associated [ Homo sapiens (human) ] |
| Official Symbol | LSM6 |
| Synonyms | LSM6; LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae); U6 snRNA-associated Sm-like protein LSm6; YDR378C; Sm protein F; |
| Gene ID | 11157 |
| mRNA Refseq | NM_007080 |
| Protein Refseq | NP_009011 |
| MIM | 607286 |
| UniProt ID | P62312 |
| ◆ Recombinant Proteins | ||
| LSM6-5612C | Recombinant Chicken LSM6 | +Inquiry |
| LSM6-6001HF | Recombinant Full Length Human LSM6 Protein, GST-tagged | +Inquiry |
| LSM6-2406R | Recombinant Rhesus Macaque LSM6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| LSM6-9335M | Recombinant Mouse LSM6 Protein | +Inquiry |
| LSM6-5611C | Recombinant Chicken LSM6 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LSM6-9171HCL | Recombinant Human LSM6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LSM6 Products
Required fields are marked with *
My Review for All LSM6 Products
Required fields are marked with *
