Recombinant Human LSMEM1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : LSMEM1-5780H
Product Overview : C7orf53 MS Standard C13 and N15-labeled recombinant protein (NP_872403) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : LSMEM1 (Leucine Rich Single-Pass Membrane Protein 1) is a Protein Coding gene.
Molecular Mass : 14.3 kDa
AA Sequence : MTHSSQDTGSCGIQEDGKLYVVDSINDLNKLNLCPAGSQHLFPLEDKIPVLGTNSGNGSRSLFFVGLLIVLIVSLALVFFVIFLIVQTGNKMDDVSRRLTAEGKDIDDLKRINNMIVKRLNQLNQLDSEQNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name LSMEM1 leucine rich single-pass membrane protein 1 [ Homo sapiens (human) ]
Official Symbol LSMEM1
Synonyms LSMEM1; leucine rich single-pass membrane protein 1; C7orf53; leucine-rich single-pass membrane protein 1
Gene ID 286006
mRNA Refseq NM_182597
Protein Refseq NP_872403
UniProt ID Q8N8F7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LSMEM1 Products

Required fields are marked with *

My Review for All LSMEM1 Products

Required fields are marked with *

0
cart-icon
0
compare icon